KEGG   Methylorubrum extorquens PA1: Mext_1639Help
Entry
Mext_1639         CDS       T00640                                 

Definition
(GenBank) Phosphoenolpyruvate carboxykinase (ATP)
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
mex  Methylorubrum extorquens PA1
Pathway
mex00010  Glycolysis / Gluconeogenesis
mex00020  Citrate cycle (TCA cycle)
mex00620  Pyruvate metabolism
mex01100  Metabolic pathways
mex01110  Biosynthesis of secondary metabolites
mex01120  Microbial metabolism in diverse environments
mex01130  Biosynthesis of antibiotics
mex01200  Carbon metabolism
Module
mex_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mex00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mext_1639
   00020 Citrate cycle (TCA cycle)
    Mext_1639
   00620 Pyruvate metabolism
    Mext_1639
Enzymes [BR:mex01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     Mext_1639
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP
Motif
Other DBs
NCBI-ProteinID: ABY30038
UniProt: A9W382
Position
1827056..1828675
Genome map
AA seq 539 aa AA seqDB search
MKTIGEFNAAHGPEAIGLTDLAAVHWNLEAPRLYEEALRRNEAQLARGGALVATTGSHTG
RSPKDKYVVRDAGTENEIWWDNNGSITPDQFATLLDDFRAHARGKELFAQDLFGGADPAH
RVRARVYTELAWHSLFIRNLLIRPERADLAAYVPELTIIDLPSFQADPARHGCRSKTVIA
IDFSQKIVLIGGSAYAGEMKKSVFTYLNYVLPGTGVMPMHCSANASLDETGDSALFFGLS
GTGKTTLSNDSSRQLIGDDEHGWSRDGIFNFEGGCYAKTIRLSRNAEPEIYATTERFGTV
MENVVIDPLTRVPDFDDASLTENTRCAYPLDFIANASATGRAGHPKNIVMLTCDAFGVMP
PIAKLTGAEAMYHFLSGYTAKVAGTERGLTAPEATFSTCFGAPFMPRHPSVYGNLLRELM
AEHGVDCWLVNTGWTGGGVGTGRRMPIRVTRRLLSAALDGSLAQVEFRRDPYFGFSVPVE
VPGVETQVLSPVETWTNKAAFADTATRLVTMFRENFKRFESHVDADVRAAEPVAAAIAA
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaccattggtgaattcaacgcggcccacggtccggaggcgatcggcctgaccgat
ctcgccgccgtccactggaacctggaggcgccgcgcctctacgaggaggccctgcgccgg
aacgaggcgcagctcgcccgcggcggcgcgctggtggcgaccactggcagccataccggc
cgctcgcccaaggacaagtacgtggtgcgcgatgccggcaccgagaacgagatctggtgg
gacaacaacggctcgatcacgcccgaccagttcgcgacgctgctcgacgatttccgcgcg
catgcccgcggcaaggaactgttcgctcaggatctgttcggcggcgccgacccggcccac
cgggtgcgggcgcgggtctataccgagctcgcgtggcactcgctgttcatccgcaacctg
ctgatccgccccgagcgcgccgatctcgccgcctacgtaccggaactgacgatcatcgac
ctgccgagctttcaggccgatccggcccggcacggctgccgctccaagaccgtcatcgcc
atcgatttcagccagaagatcgtgctgatcggcggctcggcctatgccggcgagatgaag
aagtcggtcttcacctatctcaactacgtgctgccgggcacgggcgtgatgccgatgcac
tgctcggccaatgccagcctcgacgagaccggtgattcggccctgttcttcggcctgtcc
ggcaccggcaagaccacgctctcgaacgattcctcgcgccaactgatcggcgacgacgag
cacggctggagccgggacggcatcttcaacttcgagggcggctgctacgccaagaccatc
cggctctcgcgcaacgccgagccggagatctacgccaccaccgagcgcttcggcacggtg
atggagaacgtggtgatcgatccgctcacccgcgtgccggacttcgacgacgcctcgctc
acggaaaacacccgctgcgcctatccgctggatttcatcgccaatgccagcgccaccggc
cgggccgggcatccgaagaacatcgtgatgctgacctgcgacgccttcggcgtgatgccg
ccgatcgccaagctgacgggtgccgaggcgatgtaccacttcctctcgggttacaccgcc
aaggtggcgggcaccgagcgcggcctgaccgcaccggaggcgactttctcgacctgcttc
ggcgcgccgttcatgccgcgccacccgagcgtctacggcaacctgctgcgcgaattgatg
gccgagcacggcgtcgattgctggctcgtcaacaccggctggaccgggggcggggtcggc
accgggcggcgcatgccgatccgcgtcacccgccggctgctctcggcggcgctcgacggc
tcgctggcgcaggtcgagttccgccgcgacccgtatttcggcttctcggtgcccgtcgaa
gtgcccggcgtcgagacgcaggtgctctcgccggtcgagacctggaccaacaaggcggcc
ttcgccgacaccgccacgcgcctcgtcacgatgttccgcgagaacttcaagcgcttcgag
agccacgtcgatgccgacgtgcgcgccgccgagccggtcgccgcagcgatcgcggcctga

DBGET integrated database retrieval system