KEGG   Methylobacterium extorquens PA1: Mext_1790Help
Entry
Mext_1790         CDS       T00640                                 

Definition
(GenBank) conserved hypothetical protein
Organism
mex  Methylobacterium extorquens PA1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAM184 TPR_MLP1_2
Motif
Other DBs
NCBI-ProteinID: ABY30189
UniProt: A9W3N3
Position
complement(2009382..2010104)
Genome map
AA seq 240 aa AA seqDB search
MIETVMIFGLGFLLASLCALTILPTVSARASRLARRRIEATLPVSVSEVVAERDHLRAEF
AVVQRRLERKAEAIAARRHADMAVIGTRTMETEAAVAARIRSEAEVARALERIAGLDRDL
ASARAEGETGLATLHALEEAHRAILDDLKATRRMQAATAPSGAEGETVGPASTAAEIEAL
RAELTAAQAALAARGSDDTAELRRRISEVADALARHDRLPQDRLPQAGAFPAASPALAES
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgagaccgtgatgatcttcgggctcggcttcctcctggcgagcctgtgcgccctg
acgatcctgccgaccgtgagcgcccgcgccagccgtctcgcccgacggcggatcgaggcg
accctgccggtgagcgtgtccgaggtcgtggccgagcgcgaccatctgcgcgcggagttc
gccgtcgtgcagcggcggctggagcgaaaggccgaggcgatcgccgcccggcgccacgcc
gacatggccgtcatcgggacccgcaccatggagaccgaggctgcggtcgcggcccggatc
cgcagcgaggccgaggtggcccgcgccctcgagcgcatcgccgggctcgaccgggacctc
gcctcggcgcgggccgagggtgagaccgggctcgccaccctgcacgccctggaagaggcc
caccgcgcgatcctcgacgatctcaaggcgacgcgccggatgcaggccgcgaccgcgccg
tcgggcgccgagggcgagaccgtcgggccagcttccacggcggccgagatcgaggcgctg
cgcgcggaattgacggcggcccaggcggcgctggctgcacgcgggagcgacgacaccgcc
gagctgcgccgccgcatcagcgaggtcgccgacgccttggcgcggcacgaccgtctgccc
caggatcgcttgccccaagccggagcctttccggccgcgtctcccgcgcttgccgagagc
tga

DBGET integrated database retrieval system