KEGG   Methylobacterium extorquens PA1: Mext_1791Help
Entry
Mext_1791         CDS       T00640                                 

Definition
(GenBank) conserved hypothetical protein
Organism
mex  Methylobacterium extorquens PA1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1134 PsbQ
Motif
Other DBs
NCBI-ProteinID: ABY30190
UniProt: A9W3N4
Position
complement(2010314..2011063)
Genome map
AA seq 249 aa AA seqDB search
MIDLETARSLRASIRCRFRRGKRLRAGQARAGIGAGKGAGRETDMPHDPIRTGGTTRRAA
LLGLSAGLSGGLLAGAVPALAYQDDGVRPDSFRAAEVVENGHRFFGSVSRGLALTVEEAT
RRWGEPNGYILGQEASGAIVGGLRFGEGTLYTRNAGQRRIYWQGPTLGFDVGGDGARTMM
LVYNLPAVRDLYRRFGGVDGSAYFIGGFGMTAVTDGGIIVVPIRSGVGARLGINIGYLKF
TGRPTWNPF
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
ttgatcgatctcgagactgcgcgctccctgcgtgcctcgattcgatgccgcttccgccga
gggaagcgcctgcgcgccgggcaagcccgggcgggcataggggcaggcaagggagccggt
agggagaccgacatgccgcacgatcccatccgaacggggggcacgacccgccgcgccgcc
ctgctcggcctctcggccgggctgtccggcggcctcctggccggggccgttcccgctctg
gcatatcaggacgacggcgtgcgcccggactcgttccgcgccgccgaggtggtcgagaac
gggcaccgcttcttcggcagcgtgtcgcgcggcctcgcgctcaccgtcgaggaggcgacc
cggcgctggggcgagcccaacggctacatcctcggacaggaggcgtccggcgccatcgtc
ggtggcctgcgcttcggcgagggcacgctctatacccgcaatgccggccagcgccggatc
tactggcaggggccgacgctcggcttcgatgtcggcggcgacggggcgcgcaccatgatg
ctcgtctacaacctgcccgccgtgcgcgacctctaccgccgcttcggcggcgtcgacggc
tcggcctacttcatcggcggtttcggcatgacggcggtgaccgacggcggcatcatcgtg
gtgccgatccgctccggcgtcggcgcccggctcggcatcaatatcggctatctgaaattc
accggccgcccgacctggaacccgttctga

DBGET integrated database retrieval system