KEGG   Methylobacterium extorquens PA1: Mext_1792Help
Entry
Mext_1792         CDS       T00640                                 

Definition
(GenBank) Ribonuclease H
  KO
K03470  ribonuclease HII [EC:3.1.26.4]
Organism
mex  Methylobacterium extorquens PA1
Pathway
mex03030  DNA replication
Brite
KEGG Orthology (KO) [BR:mex00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    Mext_1792
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mex03032]
    Mext_1792
Enzymes [BR:mex01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.4  ribonuclease H
     Mext_1792
DNA replication proteins [BR:mex03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    RNase H
     Mext_1792
   Elongation factors (archaeal)
     Mext_1792
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNase_HII
Motif
Other DBs
NCBI-ProteinID: ABY30191
UniProt: A9W3N5
Position
complement(2011283..2011933)
Genome map
AA seq 216 aa AA seqDB search
MAPRAKSVKAPRPFDPTLAATYPAVIGCDEVGRGALCGPVMVAAVWFDPVAFPPEILARL
DDSKRLDRAAREALTPLIRAHARVSLAAGSRALVDRVNVRGATLDAMRRAVLGLGLDATV
LVDGRDPIPGLTQGCRAVIGGDRLVPQIAAASIVAKTFRDEIMRRLAPRHPAYAWERNAG
YGTAAHLAGLTAQGRSPHHRLSFTGRFEAARGIPDA
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atggcccctcgagcaaaatccgtcaaagccccgcgcccgttcgatcctacgcttgccgcc
acctatccagcggtgatcggctgcgacgaggtcgggcgcggcgccctgtgcggtccggtg
atggtggcggccgtgtggttcgaccccgtcgcctttccgccggagatcctggcccggctc
gacgacagcaagcggctcgaccgtgccgcgcgcgaggcgctgaccccgctgatccgggcg
catgcgcgggtttcgctcgcggcgggctcgcgggcgctggtggaccgagtgaacgtgcgc
ggggcgaccctcgacgccatgcgccgggcggtcctgggcctcggcctcgacgcgaccgtg
ctggtggacgggcgcgatccgattcccggcctgacgcagggctgccgcgcggtgatcggc
ggcgaccgcctcgtgccgcagatcgccgccgcctccatcgtcgccaagacgtttcgcgac
gagatcatgcgccggctcgccccacgccacccggcctatgcctgggagcgcaatgccggc
tacggcaccgccgcccacctcgccggcctcaccgcgcaaggccgcagcccgcaccacagg
ctgagtttcacgggacggttcgaggccgcgcgcggcatccccgacgcgtga

DBGET integrated database retrieval system