KEGG   Methylorubrum extorquens PA1: Mext_1799Help
Entry
Mext_1799         CDS       T00640                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K14067  malate-CoA ligase subunit beta [EC:6.2.1.9]
Organism
mex  Methylorubrum extorquens PA1
Pathway
mex00630  Glyoxylate and dicarboxylate metabolism
mex00680  Methane metabolism
mex01120  Microbial metabolism in diverse environments
mex01200  Carbon metabolism
Module
mex_M00346  Formaldehyde assimilation, serine pathway
Brite
KEGG Orthology (KO) [BR:mex00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Mext_1799
  09102 Energy metabolism
   00680 Methane metabolism
    Mext_1799
Enzymes [BR:mex01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.9  malate---CoA ligase
     Mext_1799
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 Succ_CoA_lig Swi5
Motif
Other DBs
NCBI-ProteinID: ABY30198
UniProt: A9W3P2
Position
2019358..2020530
Genome map
AA seq 390 aa AA seqDB search
MDVHEYQAKELLASFGVAVPKGAVAFSPDQAVYAATELGGSFWAVKAQIHAGARGKAGGI
KLCRTYNEVRDAARDLLGKRLVTLQTGPEGKPVQRVYVETADPFERELYLGYVLDRKAER
VRVIASQRGGMDIEEIAAKEPEALIQVVVEPAVGLQQFQAREIAFQLGLNIKQVSAAVKT
IMNAYRAFRDCDGTMLEINPLVVTKDDRVLALDAKMSFDDNALFRRRNIADMHDPSQGDP
REAQAAEHNLSYIGLEGEIGCIVNGAGLAMATMDMIKHAGGEPANFLDVGGGASPDRVAT
AFRLVLSDRNVKAILVNIFAGINRCDWVAEGVVKAAREVKIDVPLIVRLAGTNVDEGKKI
LAESGLDLITADTLTEAARKAVEACHGAKH
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atggacgttcacgagtaccaagccaaggagctgctcgcgagctttggggtcgccgtcccg
aagggcgccgtggctttcagcccggatcaagcggtctacgcggcgaccgagctcggcggg
tcgttctgggcggtgaaagcccagatccatgccggagcgcgcggcaaggcgggcgggatc
aagctctgccgcacctacaatgaagtgcgcgacgccgcccgcgacctgctgggaaaacgc
ctcgtgacgctccagaccggccccgagggcaagccggtgcagcgcgtctatgtcgagacc
gccgacccgttcgagcgtgaactctatctcggctacgtcctcgatcggaaggccgagcgc
gtccgcgtcatcgcctcccagcgcggcggcatggatatcgaagagatcgccgccaaggag
cccgaggctctgatccaggtcgtggtcgagccggccgtcggactgcagcagttccaggcc
cgcgagatcgcgttccagctcggcctcaacatcaagcaggtctcggccgcggtgaagacc
atcatgaacgcctaccgggcgttccgcgactgcgacggcaccatgctggagatcaacccg
ctcgtcgtcaccaaggacgaccgggttctggcactcgacgccaagatgtccttcgacgac
aacgccctgttccgccgccgcaacatcgcggacatgcacgacccgtcgcagggcgatccc
cgcgaggcccaggctgccgagcacaatctcagctatatcggcctcgagggcgaaatcggc
tgcatcgtcaacggcgcgggtctggccatggcgaccatggacatgatcaagcacgcgggc
ggcgagccggcaaacttcctggatgtgggcggcggtgccagcccggatcgcgtcgccacg
gccttccgcctcgtcctctcggaccgcaacgtgaaggcgatcctcgtcaacatcttcgcc
ggcatcaaccgctgcgactgggtcgcggagggcgtggtgaaggccgcgcgcgaggtgaag
atcgacgtgccgctcatcgtgcggctcgctggcacgaacgtcgatgaaggcaagaagatc
ctcgccgagagcgggctcgacctcatcaccgccgacacccttacggaagccgcgcgcaag
gctgtcgaagcctgccacggcgccaagcactga

DBGET integrated database retrieval system