KEGG   Methylorubrum extorquens PA1: Mext_1804Help
Entry
Mext_1804         CDS       T00640                                 

Definition
(GenBank) Carboxymethylenebutenolidase
  KO
K01061  carboxymethylenebutenolidase [EC:3.1.1.45]
Organism
mex  Methylorubrum extorquens PA1
Pathway
mex00361  Chlorocyclohexane and chlorobenzene degradation
mex00364  Fluorobenzoate degradation
mex00623  Toluene degradation
mex01100  Metabolic pathways
mex01110  Biosynthesis of secondary metabolites
mex01120  Microbial metabolism in diverse environments
mex01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mex00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00364 Fluorobenzoate degradation
    Mext_1804
   00361 Chlorocyclohexane and chlorobenzene degradation
    Mext_1804
   00623 Toluene degradation
    Mext_1804
Enzymes [BR:mex01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.45  carboxymethylenebutenolidase
     Mext_1804
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DLH BAAT_C Peptidase_S9 Hydrolase_4 Abhydrolase_2 Chlorophyllase2 Abhydrolase_1 Chlorophyllase AXE1
Motif
Other DBs
NCBI-ProteinID: ABY30203
UniProt: A9W3P7
Position
2026506..2027381
Genome map
AA seq 291 aa AA seqDB search
MTAFDADLRSLAAQTTFSRRTVIATSLATGFALAVQPVAAQTTITTDTNGLIAGEVKIPT
QDGEIPAYRAMPAEGGPFPTILVVQEIFGVHEHIKDVCRRLAKLGYFALAPELYARQGDV
STLTNIQQIVSEVVSKVPDAQVMSDLDAAVAFAKGTGKADTARLGITGFCWGGRITWLYA
AHDPAVKAGVAWYGRLVGDSSALMPKNPVDVAADLKAPVLGLYGGADQGIPVATIDRMKE
ACRAAGKTCDFVVYPEAGHAFHADYRPSYRAEPAQDGWKRLQDWFRQHGVA
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgttcgatgccgacctgcggagcctcgcggctcagacgactttctcaaggcgc
accgtgatcgccacgagtctcgccacgggcttcgcgctcgccgttcagcccgtcgcggcc
cagaccaccatcaccacggacacgaacggcctgatcgccggcgaggtgaagattccgacg
caggacggtgagatcccggcctaccgggccatgccggccgagggcggccccttcccgacg
atcctggtcgtgcaggaaatcttcggcgtgcacgagcacatcaaggatgtgtgccgccgg
ctggccaagctcggctatttcgccctagcgcccgaactctatgcccggcagggcgacgtc
tcgaccttgaccaacatccagcagatcgtgagcgaggtcgtctccaaggtgcccgacgca
caggtgatgagcgacctcgacgcggcggtcgccttcgccaagggcacgggcaaggccgac
acggcccgcctcgggatcaccggcttctgctggggcgggcgcatcacctggctctacgcc
gcgcacgatccggcggtgaaagccggcgtcgcttggtacgggcggctcgtcggcgacagc
tcggcgctgatgccgaagaaccccgtcgatgtcgccgccgatctcaaggcgccggtgctc
ggcctctatggtggggccgatcagggcatcccggtcgcgacgatcgaccggatgaaggag
gcctgtcgggccgccggaaagacctgcgatttcgttgtctatccggaggcggggcacgcc
ttccatgccgattatcgtccgagctaccgcgcggagccggcacaagacggatggaagcgg
ctacaggactggttccggcagcacggcgtcgcctga

DBGET integrated database retrieval system