KEGG   Methylorubrum extorquens PA1: Mext_1805Help
Entry
Mext_1805         CDS       T00640                                 

Definition
(GenBank) transcriptional coactivator/pterin dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
mex  Methylorubrum extorquens PA1
Pathway
mex00790  Folate biosynthesis
mex01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mex00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Mext_1805
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mex04147]
    Mext_1805
Enzymes [BR:mex01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     Mext_1805
Exosome [BR:mex04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mext_1805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-ProteinID: ABY30204
UniProt: A9W3P8
Position
complement(2027389..2027766)
Genome map
AA seq 125 aa AA seqDB search
MTQAREGVLDDATVERRLKEELPHWRLEDGWIRRTYKTASWKSTLMVINTVGHLAEAAWH
HPDLTASYAWVEVRLMNHAAKGITEKDFSLAKKIEEVVGWQPGTEGGALEGTPTDPRFAY
IKYDK
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaagcacgcgagggcgtcctcgacgacgcgacggtggagcggcggctgaaggaa
gagttgccgcactggcggttggaggacggctggatccggcggacctacaagaccgcttcg
tggaagagcacgctgatggtcatcaacacggtgggccatctggccgaggccgcgtggcac
caccccgacctcaccgcgtcctacgcctgggtcgaggtccggctgatgaaccacgccgcc
aaaggcatcaccgagaaggatttttcgctggcaaagaagatcgaggaggtcgtgggctgg
cagcccggcacggagggcggcgccctcgaagggacgccgaccgatccgcgcttcgcctat
atcaagtacgacaagtaa

DBGET integrated database retrieval system