KEGG   Methylobacterium extorquens PA1: Mext_1807Help
Entry
Mext_1807         CDS       T00640                                 

Definition
(GenBank) binding-protein-dependent transport systems inner membrane component
  KO
K02050  NitT/TauT family transport system permease protein
Organism
mex  Methylobacterium extorquens PA1
Module
mex_M00188  NitT/TauT family transport system
Brite
Transporters [BR:mex02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   NitT/TauT family transporter [MD:M00188]
    Mext_1807
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: ABY30206
UniProt: A9W3Q0
Position
2029028..2029762
Genome map
AA seq 244 aa AA seqDB search
MALLARLLSLAVLLVLWQGLSAYADTRTLPAPSAVFAFILREAQSGSLFFNVGVTLARVA
VSFVIAMSLGVLLGIALGRSRLADRLLDTPLLVVLNTPALVITVLAYVWLGLTETAAIVA
VALNKLPNVAVIMREGARGLDPGLEEMATTYRFDRRTWIAHVLLPQLQPFMVAAARSGIS
LAWKIVLVVELLGRPNGVGFAINYYFTLFDVTAVIGYSLVFMSVMLALDSLLLQPLDAHV
RRWR
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atggccctgctcgcacgcctcctctcgctcgccgtcctcctcgtcctctggcagggcctc
tccgcctatgccgacacgcggaccctgccggcgccgagcgcggtgttcgccttcatcctg
cgtgaggcgcagagcggcagcctgttcttcaatgtcggcgtcacgctcgcccgggtcgcg
gtctccttcgtgatcgccatgagcctcggcgtgctgctcggcatcgcgctcggccgctcg
cgcctcgccgaccggctgctcgacacgccgcttctcgtcgtcctcaacacgccggccctc
gtcatcacggtgctggcctatgtctggctcgggctgaccgagaccgcggccatcgtcgcg
gtcgcgctcaacaagctgcccaacgtcgccgtcatcatgcgcgagggcgcccgcggcctc
gatccggggctggaggagatggcaacgacctatcgcttcgaccggcggacctggatcgcc
catgtgctgctgccgcagctccagcccttcatggtggcggcggcgcgctccggcatctcg
ctcgcctggaagatcgtgctggtggtggagctgctgggccgtcccaatggggtcggcttt
gccatcaactattacttcacgctcttcgacgtcaccgcggtgatcggctacagcctcgtc
ttcatgagcgtgatgctcgccctcgactctctcctcctccagcccctcgacgcccatgtc
cgccgctggcgctga

DBGET integrated database retrieval system