KEGG   Methylorubrum extorquens PA1: Mext_1810Help
Entry
Mext_1810         CDS       T00640                                 

Definition
(GenBank) hypothetical protein
Organism
mex  Methylorubrum extorquens PA1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrome_CBB3 Cytochrom_C
Motif
Other DBs
NCBI-ProteinID: ABY30209
UniProt: A9W3Q3
Position
2033150..2033773
Genome map
AA seq 207 aa AA seqDB search
MMVSGETSLSSMKRTALLGLVGAALLGAVPAATVAFAQDAKPELANKLDPNAKEIDEPVL
KAATAAKEEDGKYFDKDGHPTFHITNDGKKVDWFTYSGYRRYHAECHVCHGPDGMGSTYA
PALKDSLKRLSYEEFYGILAGGKQEISNTANQVMPAFGDNKNVMCYANDLYVYLRARAAG
AWGRARPGEKEDKPESAKTVEKECLGG
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgatggtctcgggagaaacgtcgttgtcttcgatgaaaagaaccgctcttcttggtctc
gtcggtgcagccttgctcggagcggttcccgccgccaccgttgccttcgcccaggacgcc
aagcccgaactcgccaacaagctcgatccgaacgccaaagagatcgacgagccggtgctc
aaggccgccacagcggcgaaggaagaggacggcaagtacttcgataaggacggtcacccg
accttccacatcaccaacgacggcaagaaggtcgattggttcacctattccggctatcgc
cgctatcacgccgagtgccacgtctgccacggcccggacggcatgggctcgacctacgcg
cccgccctcaaggactcgctgaagcgcctctcctacgaggagttctacggcatcctcgcc
ggcggcaagcaggagatcagcaacaccgccaaccaggtgatgcctgccttcggcgataat
aagaacgtgatgtgctacgccaacgacctctacgtgtacctgcgcgctcgcgccgccggt
gcctggggccgggcccgtccgggcgagaaggaagacaagcccgaaagcgccaagaccgtt
gagaaggagtgcctgggcggctga

DBGET integrated database retrieval system