KEGG   Methylorubrum extorquens PA1: Mext_1817Help
Entry
Mext_1817         CDS       T00640                                 

Definition
(GenBank) coenzyme PQQ biosynthesis protein E
  KO
K06139  pyrroloquinoline quinone biosynthesis protein E
Organism
mex  Methylorubrum extorquens PA1
Brite
KEGG Orthology (KO) [BR:mex00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    Mext_1817
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM SPASM Fer4_12 Fer4_14
Motif
Other DBs
NCBI-ProteinID: ABY30216
UniProt: A9W3R0
Structure
PDB: 

Position
complement(2037632..2038786)
Genome map
AA seq 384 aa AA seqDB search
MNAPTPAPSPVDVIPAPVGLLAELTHRCPLRCPYCSNPLELDRRSAELDTQTWLRVLTEA
AGLGVLHVHLSGGEPTARPDIVEITAKCAELGLYSNLITSGVGGALAKLDALYDVGLDHV
QLSVQGVDAANAEKIGGLKNAQPQKMQFAARVTELGLPLTLNSVIHRGNIHEVPGFIDLA
VKLGAKRLEVAHTQYYGWAYVNRAALMPDKSQVDESIRIVEAARERLKGQLVIDLVVPDY
YAKYPKACAGGWGRKLMNVTPQGKVLPCHAAETIPGLEFWYVTDHSLGEIWTQSPAFAAY
RGTSWMKEPCRSCDRREKDWGGCRCQALALTGDAANTDPACSLSPLHAKMRDLAKEEAAE
TPPDYIYRSIGTNVQNPLSEKAPL
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcaccgacccccgccccctcccccgtggacgtcattccggcgccggtgggtctg
ctcgccgagctgacgcaccgctgcccgctgcgctgcccatactgctcgaacccgctggag
ctcgaccggcgctcggccgagctggacacgcagacgtggctgcgggtgctgacggaggcg
gcgggtctcggtgtgctgcatgtccacctgtcgggcggtgaaccgaccgcccgtcccgac
atcgtcgagatcacggccaaatgcgccgaactcggcctgtactcgaacctgatcacctcc
ggcgtcggcggtgccttggcgaagctcgacgcgctctacgacgtcggcctcgatcacgtg
cagctctccgtccaaggggtggacgcggccaacgcggaaaagatcggcggcctcaaaaac
gcgcagccgcagaagatgcagttcgccgcccgcgtcaccgaactcggcctgccgctgacg
ctgaactcggtgatccaccgcggcaacatccatgaggtgccgggcttcatcgacctcgcg
gtcaagctcggcgccaagcggctggaggtggcccatacccagtactacggctgggcctat
gtgaaccgcgccgcgctgatgccggataagagccaggtcgacgaatcgatccgcatcgtc
gaggccgcgcgcgagcgcctcaagggccagctcgtcatcgacctcgtggtgccggactac
tacgccaagtacccgaaggcctgcgccggcggctggggccgcaagctgatgaacgtgacg
ccgcagggcaaggtgctgccctgccacgccgccgagaccatccccggcctcgaattctgg
tatgtcaccgaccactcgctcggcgagatctggacccaatccccggcctttgccgcctat
cgcggcacaagctggatgaaggagccctgccgctcctgcgaccggcgcgagaaggattgg
ggcggctgccgctgccaggcgctggcgctcacgggcgacgcggccaacaccgatccggcc
tgctccctttcgccgctgcacgcgaaaatgcgggatcttgccaaggaagaggctgccgag
accccgcccgattatatataccgcagcatcgggacgaatgtgcaaaacccgttgagcgaa
aaggcacccctttga

DBGET integrated database retrieval system