KEGG   Methylobacterium extorquens PA1: Mext_1830Help
Entry
Mext_1830         CDS       T00640                                 

Definition
(GenBank) protein of unknown function DUF201
Organism
mex  Methylobacterium extorquens PA1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_3 ATPgrasp_Ter Dala_Dala_lig_C SIMPL
Motif
Other DBs
NCBI-ProteinID: ABY30229
UniProt: A9W3S3
Position
2051250..2052374
Genome map
AA seq 374 aa AA seqDB search
MLDLFGDEDTLALAESHRPLPGRFGAGARDRSGVLAGLDALSKEAGSTLGVVLGSGFEAA
PDLIAKIAGRHRLLGAGAETVAALKDPFGFAALCERLAIPHPEVSAGPVADWAAWLLKRA
GGCGGSHIRASAAGTTPPGHYLQARMPGSAFALNFLSDGRRIEPLALTEQWQAPSPLRPF
RYAGALARGRDEAAAIPAAVAAEIAEAALRLARATGLTGLASADCLVDGESWWLLEINPR
PGATFDVLDHRPTPLLIQHIEAALGRMPSIEAAPADATGAEICYAARTCAAVPPLDWPDH
VRDRPRAGSHVARDAPFCTVTASGPDAAAVKQELRARAETVRALLKETENNHEFQHERAE
PQRPGRAAGREPRR
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
gtgctcgacctgttcggcgacgaggacaccctggcgctggccgagagccaccgcccgctg
cccggccgattcggtgcgggtgcccgcgaccggtccggcgtgctggcagggctcgatgcg
ttgtctaaggaagctggcagcaccctcggcgtggtgctcggcagcggcttcgaggccgcg
ccggacctcatcgcgaaaatcgctggccgccatcgcctgctgggcgcgggcgccgagacg
gtcgcggccctcaaggatccgttcggttttgccgccctgtgtgaacgcctcgcgatcccg
catccggaggtcagcgccggcccggtcgccgattgggccgcttggctcctcaagcgggca
gggggctgcggcggttcgcatatccgcgcgagcgcggccggtacgaccccgccgggccac
tacctccaggcccggatgcccggcagcgctttcgctctgaacttcttgtccgatggccgc
cgcatcgaacccctggcgctgaccgagcagtggcaggcgccctcgccgctgcggccgttc
cgctatgccggcgcgctcgcccgcggccgcgacgaggcggcggcgatcccggcggcggtc
gccgcggagatcgccgaggcggcgcttcggctcgctcgcgccactggcctcaccggtctt
gccagcgccgattgcctcgtggacggggaaagctggtggctgctggagatcaatccgcgc
cccggcgccaccttcgacgtgctcgatcaccgcccgacgccgctcctgattcagcatatc
gaggcggcgctcggccggatgccgtcaatcgaggccgccccggcggatgcgacgggcgcc
gagatctgttacgcggcccggacctgcgcggcggtgccgccgctcgactggccggaccac
gtgcgggaccggccgcgggccggcagccacgtggcgcgcgacgcaccgttctgcacggtg
acggcctccgggccggacgccgcggcggtcaagcaagaattgcgggcgagggccgagacg
gtccgcgcgctgctgaaggaaacggagaacaatcatgagttccaacacgagcgcgccgag
cctcaacgccctggccgggccgctggtcgagagcctcgtcgctga

DBGET integrated database retrieval system