KEGG   Methylobacterium extorquens PA1: Mext_1838Help
Entry
Mext_1838         CDS       T00640                                 

Definition
(GenBank) 40-residue YVTN family beta-propeller repeat protein
Organism
mex  Methylobacterium extorquens PA1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lactonase NHL SGL Cytochrom_D1 Glu_cyclase_2 Peptidase_A24
Motif
Other DBs
NCBI-ProteinID: ABY30237
UniProt: A9W3T1
Position
complement(2058283..2059383)
Genome map
AA seq 366 aa AA seqDB search
MRCSLRLTGRLLPLPFAGEGGPRRGAGEGLAPYCPEASLPSPASHPRGTLPRRGGRAFIA
LAYLLTSGAPALAQEALVTAQLGNAVEIIDLASKTILQSIPVPGAPAGIAVSPDRKTAYV
TRPEGHGVSVIDLDTRRVRASLDLPGGPLGIGVNPKSGEVYVADWYGARVFVLRPNAAGL
TLEGEIATGKSPSGIAVTPDGATLLVANRESDSVSIIDVGSRRETRHVPVGQHPFGLTLS
ADGRYAYTANVVSNDVSAIDVAAGRETGRVTTGQRPYVIAFAAGKGFVTDQYSNTVTVFD
PASLKKVAAIDVGDHPEGIAATRDGRTIVVANWGDNALSLIDPSSLTVTGTIATGDGPRA
FGDFLR
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgcgctgctcacttcggctcacaggccggctcctccctctccccttcgcgggagagggt
ggcccccgaaggggggcgggtgaggggctggctccgtattgtccggaagcgtcgctcccc
tctcccgcctcgcatccgcgaggcaccctcccccgcagaggggggagggcatttatagcc
cttgcctaccttctgacatccggcgcccccgccctggcgcaggaagccctggtcacggcg
cagctcggaaacgccgtcgagatcatcgacctcgcgtccaagacaatcctgcaatcgatc
cccgtaccgggggcgccggcgggcatcgccgtctcgcccgaccggaagacggcctacgtc
acccgccccgagggccacggcgtctcggtgatcgatctcgacacgcgccgggtgcgtgcg
agcctcgatctgcccggcggcccgctcggcatcggcgtcaacccgaaatccggcgaggtc
tacgtcgccgactggtacggtgcgcgcgtcttcgtgctgcgcccgaatgcggcgggcctg
acgctggagggcgagatcgccaccgggaaatctccctccggcatcgcggtgacgccggac
ggcgccacgctgctggtggccaaccgtgaatccgactcggtctcgatcatcgacgtggga
agccgccgggagacacggcacgtgcctgtgggccagcacccgttcggcctgaccctctcg
gcggacggccgctacgcctacaccgccaacgtggtctcgaacgacgtctcggccatcgac
gtcgccgccggccgcgagaccggtcgcgtcaccaccggccagcggccctacgtgatcgca
ttcgccgccggcaaaggcttcgtgaccgaccagtattccaacaccgtgacggtgttcgac
ccggccagcttgaagaaagtggccgcgatcgatgtcggcgaccaccccgagggcatcgcc
gccacccgcgacgggaggacgatcgtcgtcgccaactggggcgacaacgccctgagcctg
atcgacccgtcgagcctcacggtcaccggcacgatcgcgaccggcgacgggccacgcgcc
ttcggggatttcctgcggtag

DBGET integrated database retrieval system