KEGG   Methylobacterium extorquens PA1: Mext_1839Help
Entry
Mext_1839         CDS       T00640                                 

Definition
(GenBank) conserved hypothetical protein; putative signal peptide
Organism
mex  Methylobacterium extorquens PA1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Polyketide_cyc2 COXG DUF4148
Motif
Other DBs
NCBI-ProteinID: ABY30238
UniProt: A9W3T2
Position
complement(2059515..2060045)
Genome map
AA seq 176 aa AA seqDB search
MKFRTLAAVAALATVTFAAQAHGPTRQKVSESIEINAPADKVWAIVGNFQDGSWIPVVEK
TEGKGGNEVKATRTLTLKGGATVEEELAKYDAEKKLLMYRITKVDVKTLPVNDYSSTIEL
EGDGAKTKMTWRGAFYRGYMNNDPPPELNDEASKKAVLGLYKAGLENVKAKAEKGS
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcaggacgctcgccgccgtggcggcgctcgccacggtaactttcgccgcgcag
gcccacggcccgacccggcagaaggtttcggagtcgatcgagatcaacgcccccgccgac
aaggtctgggcgatcgtcggcaacttccaggacggaagctggattccggtggtcgagaag
accgagggcaagggcggcaatgaggtcaaggcgacccgcacgctgaccctgaagggcggc
gccacggtcgaggaagaactcgccaaatacgacgccgagaagaagctcctcatgtaccgg
atcaccaaggtcgacgtgaagaccctgccggtgaacgattattcctcgacgatcgagctc
gagggcgacggcgccaagaccaagatgacgtggcgcggcgcgttctaccgcggctacatg
aacaacgatccgccgcccgagctgaacgacgaggcctccaagaaggccgtgctcggcctc
tacaaggcggggctggagaacgtgaaggccaaggccgagaagggctcgtaa

DBGET integrated database retrieval system