KEGG   Methylobacterium extorquens PA1: Mext_1864Help
Entry
Mext_1864         CDS       T00640                                 

Definition
(GenBank) integrase family protein
Organism
mex  Methylobacterium extorquens PA1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_integrase Arm-DNA-bind_3 Phage_int_SAM_3
Motif
Other DBs
NCBI-ProteinID: ABY30263
UniProt: A9W3V7
Position
2085744..2087033
Genome map
AA seq 429 aa AA seqDB search
MPKLTKRILDAAGARPTPYFLWCSDLKGFGVRIFPSGRRVYYADYRTAAGMRRRMSLGEH
GKLTVDEARRLAITTLGDVIRGDDPIEERVTRRKSLTIAELCRRYLEAAGAGLVLGRGRK
PKKATTLVSDRGRIEHHIVPLLGSRLVRDLTTAEVQRFVRDVQAGRTAKRYKTKARGMVL
VEGGAGAAARTAGLLGGIMSYAIGEGVIALNPVRGVKRPADRKKDRRLSPEEYRALGRVL
AEAEGDRESWQAVSSIQLLCLTGCRMREIANLRWTEVDFAGRCLRLDNTKEGRSIRPLGQ
AAVALLRQIEERRAGPYVLPATRGEGGFGGIPDAIERYSKRAGLPGIGAHTLRHSFASTA
ADLGCSDSTIGAMLGHAGHGVTSRYIHHLDAVLIMAADRVTTAMAGWLKDRYAERLEPAY
PASRTVPLS
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgccgaagctgacgaagcgcatcttggatgcggcaggagcccgtccgaccccatacttc
ctctggtgcagcgatctgaaagggttcggtgtccgcatctttccgagtgggcggcgggtc
tactacgccgactatcgaaccgcagccggtatgcgcagacgcatgtcgctgggcgagcac
ggcaagctcacggtagacgaggcgcgccgactggccatcaccacgctcggcgacgtgatc
cgcggtgacgatccgatcgaggagcgtgtcactcggcgtaagtcgctgacgatcgccgaa
ctgtgccgacggtaccttgaagcagccggagctggcttggtgctcggccgcggccggaag
ccgaagaaggctacgacgctggtctccgaccgcgggcgtatcgaacaccacatcgtcccg
ctgctcggctcgcgattggttcgtgatctgaccacggccgaggttcagcgcttcgtgcgc
gacgtccaggctggtcggacggccaagaggtacaagaccaaggctcgtggcatggtcttg
gtcgagggaggcgctggcgcggcagcacgcacggctggcttgcttggcggcataatgagc
tacgcgatcggggagggcgtcattgccctgaacccagtgcgtggcgtgaaacggccggcc
gacaggaagaaggaccgacgcctctcaccagaggagtaccgcgcgctcggccgggtgctc
gccgaggcggaaggggaccgcgagagctggcaggccgtgagcagcatccagttgctctgt
ctcaccggatgccgcatgcgggagatcgccaacctgcgttggaccgaggtagattttgcc
ggtcgctgcctccgcctcgacaatacgaaggaagggcgctcaatccggccgctcggtcaa
gccgcggtcgcactgctccgccagatcgaggagcgtcgcgctggtccctacgtgttgcct
gcgacgcgcggggagggcgggttcggcggtatcccggacgcaatcgaaagatactccaaa
cgcgctggcctcccaggcattggcgctcacaccttgcgccattcattcgcctccaccgcg
gcagaccttggctgcagcgactcgacgattggagcgatgctcggccacgccgggcacggt
gtaacctcgcggtacatccatcacctcgacgcagtgctgatcatggcggcggatcgagtc
acgactgcgatggcagggtggctcaaggatcgatatgcagagaggctagagccggcctat
cccgccagcaggactgtaccgcttagctag

DBGET integrated database retrieval system