KEGG   Methylobacterium extorquens PA1: Mext_1867Help
Entry
Mext_1867         CDS       T00640                                 

Definition
(GenBank) hypothetical protein
Organism
mex  Methylobacterium extorquens PA1
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABY30266
UniProt: A9W3W0
Position
2090183..2090449
Genome map
AA seq 88 aa AA seqDB search
MATRHSTAPARAGERLRSPSALYARQSPLLEVDEAAPGSIEPWQAVTPVRPDTAHVRALR
FLDLSGEMISALVIVAGGVLAYGFVQIG
NT seq 267 nt NT seq  +upstreamnt  +downstreamnt
atggctacccgtcattctacagcaccggcacgcgccggtgaacggctacgctcgccttcc
gcgctctatgcgcggcaatctccgctcctcgaggtcgatgaggccgcgcccggttcgatc
gagccctggcaggccgtcacgcccgtccggccggacacagcgcacgtccgcgccctacgc
ttcctcgacctcagcggcgagatgatctcggctctggtcatcgtcgccggaggcgtactc
gcctacggtttcgtgcagatcgggtga

DBGET integrated database retrieval system