KEGG   Methylobacterium extorquens PA1: Mext_1874Help
Entry
Mext_1874         CDS       T00640                                 

Definition
(GenBank) protein of unknown function DUF1376
Organism
mex  Methylobacterium extorquens PA1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1376
Motif
Other DBs
NCBI-ProteinID: ABY30273
UniProt: A9W3W7
Position
2094287..2095234
Genome map
AA seq 315 aa AA seqDB search
MSPLPTLPLLVDAFIADTAHMTVEEVGAHIRLLVFAWRSPGCCLPDDDARLARMLGLTAK
RWAALKPNVMALWQRNSEGNFTHDRLTHEHQFVTSKIEKKRAAGRLGGRPKSLEFQDQDK
ASGSAIGKQNESERKPPTPTPTESPLSPSGEDPDGFAEFQLAYPARNVRFRAAEARKRWL
EARKRGAEPAEIIAGAKAYAAEQQRIGKVGTEFVQSADVWLNKQRWRDYIGSAPLAGQPG
SLGGQSPDHRAFLDSLTDDDWRGHVQRWRQTGGQWLLAQRTAPPDHPRTMVPQHILDEFG
LGVVRDLPVLMTGTR
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
gtgagcccgctgccgacgctgccgctcctcgtcgacgccttcatcgccgacaccgcacac
atgaccgtcgaggaggtgggtgcgcatatccgcctgctggtgttcgcgtggcgctcgcct
gggtgctgcctgcccgacgatgacgctcggcttgcccggatgctcggcctgacagccaag
cgctgggcagcactcaagccgaatgtgatggcgctgtggcagcgcaattcggagggtaat
ttcacccacgatcggctcactcacgagcatcaattcgtcacgagtaaaattgagaagaag
cgcgccgccgggaggctcggcggacggcctaagtcattggaatttcaggatcaggacaaa
gcatcaggttctgcaattggaaagcagaacgaaagcgaacgcaaaccacctacacctaca
cctacagaatcccctttatccccttccggggaagacccagacggctttgccgaattccaa
ttggcctacccggcaaggaatgttcgtttccgggcagcagaggctcggaagcgttggctg
gaagcccggaagcgaggcgcggagcctgcggagatcatcgccggggcgaaggcctatgcc
gccgaacagcagcgcatcggcaaggtcggcaccgagttcgtgcagtcggccgacgtctgg
ctgaacaagcagcgatggcgcgattacatcgggtcagcgccgctggccgggcagcccgga
tcgttgggtggccagtcgccggaccatcgcgccttcctcgacagcctgaccgacgacgat
tggcggggccacgtgcagcgctggcggcaaacgggcgggcagtggctgctcgcccagcgc
accgcgccgcccgaccacccgcggacgatggtaccgcagcacatcctcgacgagttcggt
ctcggcgtcgtccgagatctgcctgtcctgatgacggggacacgctaa

DBGET integrated database retrieval system