KEGG   Methylobacterium extorquens PA1: Mext_1875Help
Entry
Mext_1875         CDS       T00640                                 

Definition
(GenBank) conserved hypothetical protein
Organism
mex  Methylobacterium extorquens PA1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_AsnC-type HTH_24 HTH_23 HTH_38 MarR_2 HTH_Crp_2 HTH_IclR HTH_29 Fe_dep_repress Sigma70_r4_2 TetR_N GerE LacI
Motif
Other DBs
NCBI-ProteinID: ABY30274
UniProt: A9W3W8
Position
2095234..2096310
Genome map
AA seq 358 aa AA seqDB search
MSNLDTFAKVRALHDRTTNPGEKAAAASRMEALAHSAGMTITEAVSKLDAPKAPPAVPRN
IFEDLFNTPEFRAQRAERQREYAERRIAALAEYGSEDAVWEPSDREHALEAACRPVIVRK
PIINGEMDTLQGWEGGRWGQLPPAAQAAVSSAYAPPASVHEAWAEFRFWEKLADDRVAFF
EHHDHDARVRGRISFVEHLLDTMPARSMGDLRARLDWMQHLHDRRWSRGDPEDGELLATL
RADIERMGPRLRDQDAAAVQDGQSEGPAQGADPLRSPDWARASLDVQDGHSQGGSPREYP
SRRTNANKRRDVIALLDAEDPGIAPLTNREIARRVGVSPTTVGTIRRMRSSGLMTGRC
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgtccaatctggacaccttcgccaaggtccgcgcccttcacgatcggaccaccaatcca
ggcgagaaggctgctgcggcgagccggatggaagcgctcgcccattccgccgggatgacc
atcaccgaggcggtgtccaagttggacgcgccgaaggcgcctccagccgttccccgcaac
atcttcgaggatctattcaacaccccagaatttcgcgcgcagcgcgccgaacgccagcgc
gagtatgctgaacgcagaatcgctgccctggccgagtacggcagcgaggatgcggtgtgg
gagcccagcgaccgcgagcatgcgttggaggctgcttgccgccccgtcatcgtccgcaag
ccaatcattaacggtgagatggacaccctacagggctgggaaggcggcaggtggggtcag
ctgccgcccgcggcacaagcggccgtctccagcgcctatgcgcctcccgcgtcggtacac
gaggcctgggctgagttccggttctgggaaaagctcgctgacgaccgcgtggccttcttc
gagcaccacgatcacgatgcgagggtgcgcggccggatcagcttcgttgagcacctgctg
gacaccatgccggcccggtcgatgggcgatctccgggcgcgcctcgattggatgcagcac
ctgcatgatcgccgttggagccgtggcgacccggaggacggcgagctactggccaccctt
cgcgccgacatcgagcgcatgggcccgcggctgcgggaccaggatgcggcagctgtccaa
gatggacaatccgagggccccgcacagggtgcggatcctttgcgctccccagattgggcg
cgcgcaagtctcgatgtccaagatggacattcgcaagggggatcgccccgtgaatatccc
tcacgccgtaccaacgcgaacaagcgccgggacgtcatagcgctgctcgatgccgaggat
cccggcattgccccgctcaccaaccgcgagatcgcccgccgcgtcggcgtctccccgacc
accgttggcactatccgccggatgcggtcgtccggcctcatgacggggaggtgctga

DBGET integrated database retrieval system