KEGG   Methylorubrum extorquens PA1: Mext_1882Help
Entry
Mext_1882         CDS       T00640                                 

Definition
(GenBank) response regulator receiver
Organism
mex  Methylorubrum extorquens PA1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg
Motif
Other DBs
NCBI-ProteinID: ABY30281
UniProt: A9W3X5
Position
2103182..2103508
Genome map
AA seq 108 aa AA seqDB search
MLKPFPPLPPSVCMEQLTASSPAVALIAEDEFILRMEAADTLTDAGFKVLKMAAADAALR
YLQQEDGVDLLFTDVNMPGDLNGFDLAREVAIYWPEILIVVCSGATKP
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaacctttcccgccgcttccaccttctgtttgcatggaacagcttactgcgtcg
tctcccgccgtggccttgattgccgaagatgagtttatccttcgcatggaggctgccgac
acgctgaccgatgccgggtttaaggtcttgaagatggccgctgccgatgcggcgctgcgc
tacttgcagcaggaggacggcgtcgacctactgttcaccgatgtgaacatgccgggtgac
ctcaatggcttcgacctagcccgcgaagtcgctatctactggccagagatcctgatcgtg
gtgtgctcgggtgcgaccaagccttga

DBGET integrated database retrieval system