KEGG   Methylorubrum extorquens PA1: Mext_1883Help
Entry
Mext_1883         CDS       T00640                                 

Definition
(GenBank) conserved hypothetical protein
Organism
mex  Methylorubrum extorquens PA1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3597 BetaGal_dom3
Motif
Other DBs
NCBI-ProteinID: ABY30282
UniProt: A9W3X6
Position
complement(2104190..2104366)
Genome map
AA seq 58 aa AA seqDB search
MKLLDLDSSLQARKQLADELHYTGDKEDSATMNVWLHSRVVQKLAENGGKVPDDLNHA
NT seq 177 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgctcgacctcgacagcagcctgcaggcccgcaagcagctcgccgacgagctg
cactacacgggtgacaaggaggactcggccacgatgaacgtctggctgcacagccgagtg
gtgcagaagctcgccgagaacggtggcaaggtccccgacgacctcaaccacgcgtga

DBGET integrated database retrieval system