KEGG   Methylorubrum extorquens PA1: Mext_1884Help
Entry
Mext_1884         CDS       T00640                                 

Definition
(GenBank) protein of unknown function DUF937
Organism
mex  Methylorubrum extorquens PA1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF937 SelB-wing_2 YcaO
Motif
Other DBs
NCBI-ProteinID: ABY30283
UniProt: A9W3X7
Position
complement(2104763..2105254)
Genome map
AA seq 163 aa AA seqDB search
MSDGYPSMTALLGLLALAGYQNRDKLAELLGGTGQGGAPAGASPAPGGAGGTAGGPGGGL
GGLLGGLLGNQRSAGPAGFLNSGLGEMLERFHQAGHGPAAQSWVNQGPNQEIAPHHLERA
IGPDVLATLTQRTGLSREELLSRLSRDLPQAIDRYTPDGRVPA
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacggctacccctcgatgacggcgctcctcggtctgctggcgctggcgggctac
cagaacagagacaagctggcggagctgctcggcggcaccggccaaggcggcgctcccgca
ggagccagtcccgcgcccggcggagccggcggcacggccggtggccctggtggaggcttg
ggcggcctgctcggtggcttgttgggtaaccagcgcagcgcgggtccggctggtttcctg
aacagcggcctgggcgagatgctggagcgcttccaccaagccggccacgggccggctgcg
cagtcctgggtcaaccagggaccgaaccaggagattgccccgcaccacttggagcgggcg
atcggtcccgacgtgttggcgaccctgacgcagcgcaccggcttgtcccgggaggaattg
ctgtcccggctatcccgagaccttccgcaggccatcgaccggtacacgcctgacggtcgc
gtcccggcctga

DBGET integrated database retrieval system