KEGG   Methylobacterium extorquens PA1: Mext_1887Help
Entry
Mext_1887         CDS       T00640                                 

Definition
(GenBank) protein of unknown function DUF1452
Organism
mex  Methylobacterium extorquens PA1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iron_permease Polysacc_deac_2 DUF883
Motif
Other DBs
NCBI-ProteinID: ABY30286
UniProt: A9W3Y0
Position
complement(2107178..2107627)
Genome map
AA seq 149 aa AA seqDB search
MPASRAFTAFAGKVAKWAGHPLAFAPGTAIVVGWAVSGPFFGYSETWQLVINTGTTIVTF
LMVFLIQSSQNRDGAAIQAKLDELIRASAAQNRYIGIEHLTEAELDEFRQRCETRAKAER
LDDVREAADQAEVRAREKAARAASRAAGG
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcatcgcgcgcgttcaccgcctttgccggcaaggtcgccaagtgggccgggcac
cctctcgccttcgcgccgggtactgccatcgtcgtcggctgggccgtcagtggtccgttc
ttcggctactcggagacctggcagctcgtcatcaacaccggcactaccatcgtgaccttc
ctgatggtgttcctgatccagagctcgcagaaccgggacggggcggccatccaggccaag
ctcgacgagctcatccgagccagcgctgcccagaaccgctacatcggcatcgagcacctc
accgaggcggaactcgacgaattcaggcagcgctgcgagacgcgcgccaaggcggagcgc
ctggacgacgtcagggaagccgccgaccaagccgaagtccgtgcccgcgagaaggcggca
cgcgcggcgtccagggcggcaggaggttga

DBGET integrated database retrieval system