KEGG   Methylobacterium extorquens PA1: Mext_1889Help
Entry
Mext_1889         CDS       T00640                                 

Definition
(GenBank) ATP-binding region ATPase domain protein
Organism
mex  Methylobacterium extorquens PA1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg HATPase_c HPTransfase HATPase_c_3
Motif
Other DBs
NCBI-ProteinID: ABY30288
UniProt: A9W3Y2
Position
complement(2109098..2109940)
Genome map
AA seq 280 aa AA seqDB search
MESAVLNLALNARDAMPGGGRLTIELGNKVLDEAYARHHAEVTPGDYAMVAVSDTGHGMT
SDVVARVFEPFFTTKPDGKGTGLGLAMVFGFVKQSGGHVKIYSEPGEGTSVKLYLPRAIG
AAAVACQRTGSPVELPRGSATVLVVEDEAAVREIACAILADLGYRVLEAADGEEALRVFG
ANTAAIDLLLTDVVLPGKVRGRELAERVQALRPQVRVVFMSGYTENSIVHHGRLDDGVQL
IGKPFKREQLARKVAQVLGTTTVPAAEAGNVVALRLKRDV
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
gtggagagcgcggttctcaacctggcgctgaacgcgcgcgacgccatgccgggcggcggc
cggctcaccatcgagctcggcaacaaggtgctggatgaagcctacgcccgccaccacgcg
gaggtgacaccgggcgactacgccatggtagcggtctccgacaccggccacggcatgacg
tcggacgtcgtggcgcgcgtcttcgagccgttcttcacgaccaagcccgacggcaagggc
accgggcttgggctcgccatggtgttcggcttcgtcaagcagtcgggcggtcacgtgaag
atctactctgagcccggcgagggcacgtcggtgaagctctacctaccgcgcgccatcggc
gcggccgcggttgcctgccagcgaaccggttcgccggtcgaactccctcgcggctccgcg
acggttctggtggtcgaggacgaggcagcggtgcgcgagatcgcctgcgcgatcctggcc
gacctcggctaccgggtgctggaggccgccgatggcgaggaggcgctgcgggtgttcggg
gcgaacacggcagccatcgacctgctgctcaccgacgtggtgctgcctggcaaggtccgg
ggccgcgagctcgcggagcgcgtccaggcgctgcggccgcaggtgcgcgtggtgtttatg
tccggctacaccgagaactccatcgtgcaccacggccggctcgacgatggggttcagctc
atcggcaagccgttcaagcgcgagcaactcgcccgcaaggtcgcccaggtgctcgggacc
accaccgtcccggccgctgaggccggcaacgtcgtcgcgctgcgcctcaagcgggacgtg
tag

DBGET integrated database retrieval system