KEGG   Methylobacterium extorquens PA1: Mext_1890Help
Entry
Mext_1890         CDS       T00640                                 

Definition
(GenBank) hypothetical protein
Organism
mex  Methylobacterium extorquens PA1
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABY30289
UniProt: A9W3Y3
Position
2109943..2110194
Genome map
AA seq 83 aa AA seqDB search
MIKVYCTNIGDAGVPDVPHPKEDLDGAIEATGSRLAYNFKSKKGPKEKPTQSILVNDKNR
VLARFRMTPQGLERVEIGTEYAD
NT seq 252 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaggtctactgcacgaacatcggcgatgcgggcgtgcccgacgtgcctcatccc
aaggaggatctggacggagcgatagaggccacgggcagccgcttagcgtacaacttcaag
tccaagaagggccccaaggagaagcctacccagtcgatcctcgtcaacgacaagaaccgg
gtcttggcgcgattccgcatgacgccacaggggctggagcgcgtagagattggaacggag
tatgccgactag

DBGET integrated database retrieval system