KEGG   Methylobacterium extorquens PA1: Mext_1893Help
Entry
Mext_1893         CDS       T00640                                 

Definition
(GenBank) Cold-shock protein DNA-binding
  KO
K03704  cold shock protein (beta-ribbon, CspA family)
Organism
mex  Methylobacterium extorquens PA1
Brite
Transcription factors [BR:mex03000]
 Prokaryotic Type
  Other transcription factors
   Others
    Mext_1893
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CSD OB_RNB Rho_RNA_bind
Motif
Other DBs
NCBI-ProteinID: ABY30292
UniProt: A9W3Y6
Position
complement(2114332..2114541)
Genome map
AA seq 69 aa AA seqDB search
MSIGTVKWFNDTKGFGFIQPEDGSKDVFVHISAVERAGMRNLIEGQKVSYEMETDRRSGK
QSAGSLQAA
NT seq 210 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcggtaccgtaaagtggttcaacgacaccaaaggcttcggcttcattcagcct
gaagacggcagcaaggacgtgttcgttcacatctccgccgtcgagcgggctggaatgcgc
aacctgattgaggggcagaaggtctcctacgagatggaaacagaccgccgctctgggaag
cagtctgccggcagcctccaggccgcctga

DBGET integrated database retrieval system