KEGG   Methylobacterium extorquens PA1: Mext_1895Help
Entry
Mext_1895         CDS       T00640                                 

Definition
(GenBank) response regulator receiver
Organism
mex  Methylobacterium extorquens PA1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg
Motif
Other DBs
NCBI-ProteinID: ABY30294
UniProt: A9W3Y8
Position
2116468..2116848
Genome map
AA seq 126 aa AA seqDB search
MTGSRAPSFSLVLVVEDEDLVRMMAVDMLEDAGCTVVEAASADEAWAMLESRQDISVLFT
DIEMPGSMNGFALAARVAERWPHIRLVVTSGRCRPAPREVPDQGKFVAKPYLADQLLSAF
DSARPV
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgaccggctcgcgtgctccttccttctctctcgtcctggtcgttgaggacgaggacctc
gtacgcatgatggcagtcgatatgctggaggatgccggctgcacggtcgtcgaggctgcg
agtgctgacgaagcctgggccatgctggagagccggcaggatatcagcgtgctcttcacc
gacatcgagatgccgggatcgatgaacggcttcgcgcttgccgctcgggttgccgagcgg
tggccgcacattcggctggtggtcacgtcggggaggtgtcgtccagcgcctcgtgaggtg
ccggaccaaggcaagttcgtagctaagccctacctggcagaccaactgctcagcgcattc
gacagcgccaggcctgtctaa

DBGET integrated database retrieval system