KEGG   Methylobacterium extorquens PA1: Mext_1896Help
Entry
Mext_1896         CDS       T00640                                 

Definition
(GenBank) hypothetical protein
Organism
mex  Methylobacterium extorquens PA1
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABY30295
UniProt: A9W3Y9
Position
2116875..2117234
Genome map
AA seq 119 aa AA seqDB search
MGGVGCQPASPHGLCRGRQSRWQAEQCPSAGGADLADQIGAMLSRKDETGGDDQLGHSDG
TSRIHGRSGGVTLYANQIVEPRDGGSALTPLKGQAHCPKHHSAKTAGARAARMSDRSGG
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
atgggcggtgtgggatgccagcctgccagcccgcacggattatgtcgcggtcggcagagt
cgctggcaggctgaacagtgcccatcggctgggggcgcagatctggccgatcaaatcggg
gctatgctgagccggaaagatgagacgggcggggacgaccaactcggccactcggatggc
acaagccgcatccatggcaggagcggcggtgtcacgctctatgctaaccagattgttgag
ccaagagatggcggctctgccctgacgccgctcaaggggcaggcgcactgcccgaaacac
cacagcgcgaagacggctggggctcgggcagcgaggatgtcagatcgctctggcggctga

DBGET integrated database retrieval system