KEGG   Methylobacterium extorquens PA1: Mext_1903Help
Entry
Mext_1903         CDS       T00640                                 

Definition
(GenBank) hypothetical protein
Organism
mex  Methylobacterium extorquens PA1
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABY30302
UniProt: A9W3Z6
Position
complement(2120692..2120922)
Genome map
AA seq 76 aa AA seqDB search
MPSILSKWTHRTMPIKALNDRKKLSSDFNEANDASIDAVLGALQAGEIPLDLAPGLPSPS
GRYDALGWPAGRRQLL
NT seq 231 nt NT seq  +upstreamnt  +downstreamnt
gtgccttccatcctgtcgaagtggacccaccgcacgatgccgatcaaggctctgaacgat
cgcaagaagctgtcgagcgacttcaacgaggccaacgacgcctctatcgacgcggtgctc
ggcgccctgcaggctggtgagatcccgctcgatctggccccgggcctacctagcccatcc
ggtcgctatgatgcactcggatggcccgcaggccgtcgccaactactttga

DBGET integrated database retrieval system