KEGG   Methylobacterium extorquens PA1: Mext_1906Help
Entry
Mext_1906         CDS       T00640                                 

Definition
(GenBank) hypothetical protein
Organism
mex  Methylobacterium extorquens PA1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Serendipity_A
Motif
Other DBs
NCBI-ProteinID: ABY30305
UniProt: A9W3Z9
Position
complement(2123744..2125480)
Genome map
AA seq 578 aa AA seqDB search
MSFRLTIWSRTGEVRSVTTDPDPAAVWYAWSKRDVRNGFGLVSHGSEGHPSFPDKRAFTQ
NPLLITEAAHHTNGGFVTAPMGGRFAHLHAVRRWSSKPLPSVEPSTPDLGFQDVPVLPHD
VTEAIRDVEVTSLTGDRRLRTALVRLDVRLGADLAGMTETDILPFLGGSRKLLDTFRAQA
KAFTERQAKRSAMYAEAAVAEARAAEQAARDKARVAQKAARFEAEALHRAARAEAFTSTP
LLETITSSLGQLDPRSREILTRKLGLRGRPETVPEMLADFDVNRSRLFQIVESSVALLDK
RDGWPSRLGKRLSRLLPVTGEEIASTPWLSGLDPERLTAIAWFGGRARVHLVETSMGPVV
GPLSTGDWLTVCRDARKLVLASDLATRPEQFLERLRAGLPEGAEGYERLLLREIGWPSEP
GVDWLLHLKGRISTSAMVRDVAGHVAGPLATGELIEAVRTYAPDASAKTIRGILGGEARH
LPDGTWERRRRWDADDPAVGKVERACIRFLEGQPQDAATLRPAALAEAIADDPELSDIEV
DADIVALAVRSSIRFEPRPSGWIVLADRYPTADTSFPR
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atgagcttccgactgacgatttggtcccgcaccggagaggtccgctccgtgaccacggac
cccgaccccgccgccgtctggtatgcatggtccaaacgcgacgtgcggaacgggttcggg
ctcgtctcgcatgggtcggaggggcacccctcgtttcctgacaagcgggcgttcacccag
aaccccttgctcatcactgaggcggcgcatcacacgaatggcgggttcgtcaccgcgccg
atgggcgggcggttcgcgcacctccacgccgtccgccggtggtcgagcaagcccctgccg
tccgtcgagccgagcacgccggatctcgggtttcaggacgtgccggtcctgccgcatgac
gtgacggaagctattcgcgatgtcgaggtgacgagcctgacaggtgaccgtcgcctcagg
accgccctagtccgcctcgacgtccgcctcggcgcggacctcgccggcatgacggaaacc
gacatccttcccttcctcggcgggagccggaagctgctcgacactttccgggctcaggcg
aaggctttcaccgagcgccaagcgaagcggtccgccatgtatgccgaggcggccgtagcc
gaggcgagagccgcagagcaggccgcacgggacaaggcgagagttgcccagaaggcagcc
aggttcgaagccgaggccctccaccgggccgccagggccgaggcattcacgtcgaccccg
ctcctcgaaaccatcacgtcctcgctcgggcagctcgacccgaggtcccgcgagatcctc
acgcgaaagttggggctcaggggtcggcccgagaccgttcccgagatgctcgcggacttc
gacgtcaaccgctccaggctcttccagatcgtcgaatcgtcggtagccttgctcgacaaa
cgcgacgggtggccgagccggctcgggaaaaggctgagccggctcctccccgtcaccggg
gaggagatagcgtccacgccttggctcagcggcctggacccggagcgcctcacggccatt
gcatggttcggaggcagggcacgggtccacctcgtcgagacctcgatgggcccggtcgtg
ggaccgctcagcacgggcgactggctcaccgtttgccgggatgcgaggaagctcgtgctg
gcgtcggacctggcaacgaggccggagcagttccttgagcggctgcgtgcgggcctgccg
gaaggtgccgagggctacgagcgcctcctcctgcgcgagatcggctggccatccgagccc
ggcgtcgactggctcctgcacctgaaaggcaggatctcgacctccgccatggtccgtgac
gtcgccgggcacgttgcaggcccgctggcgacgggcgagttgatcgaggccgtccggacc
tacgccccggacgcgtcggccaaaacgatacgaggcatcctaggtggcgaggcgaggcac
cttccggacggaacgtgggagcgccgccggcgctgggatgcggacgaccccgcggtgggt
aaggtcgagcgcgcctgcatccgcttcctcgaaggccaaccgcaggacgcagccacgctg
cggccggccgccctggcggaggccatcgccgacgacccagagctctccgacatcgaggtc
gatgcggacatcgtcgcgctggcggtgcggtcctcgattaggttcgagccgaggccgagc
gggtggatcgtgctggccgaccgctacccgacggcggacacctcgttccctcgctga

DBGET integrated database retrieval system