KEGG   Methylobacterium extorquens PA1: Mext_1908Help
Entry
Mext_1908         CDS       T00640                                 

Definition
(GenBank) regulatory protein ArsR
Organism
mex  Methylobacterium extorquens PA1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_20 HTH_5 MarR_2 HTH_Crp_2 HTH_24 HTH_IclR Rrf2 TrmB Fe_dep_repress MarR Penicillinase_R HTH_27 RP-C GntR LacI HTH_CodY HTH_11 PaaX HTH_10 LexA_DNA_bind RepL B-block_TFIIIC
Motif
Other DBs
NCBI-ProteinID: ABY30307
UniProt: A9W401
Position
2126729..2127091
Genome map
AA seq 120 aa AA seqDB search
MMDETQALAAFLALGQEHRLRLVRALVTAGPGGLASGVLADAVGVSAATVSHHLKELSHA
GLVTSRREGRSIIYSAAYPALSDLVQFLMRDCCQGHPEVCAPALAALTACDCTTGDTLHA
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
atgatggacgagacgcaagccctcgccgcctttctggcccttggacaggaacaccgcctt
cgcctggtgcgggcgctcgtgaccgccgggcccggagggctggcctccggagtcctggcc
gacgcggtcggcgtgtccgcggccaccgtgtcccatcacctgaaggagctgagccacgcc
gggctggtcacctcccggcgcgagggccgctcgatcatctacagcgccgcctacccggcg
ctgtcggacctcgtccagttcctcatgcgcgactgctgccagggccatccggaggtctgc
gccccggccctcgccgcgctcaccgcctgcgattgcaccaccggggacaccctccatgcc
tga

DBGET integrated database retrieval system