KEGG   Methylorubrum extorquens PA1: Mext_1914Help
Entry
Mext_1914         CDS       T00640                                 

Definition
(GenBank) transcriptional regulator, ArsR family
Organism
mex  Methylorubrum extorquens PA1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_20 HTH_5 TrmB HTH_24 MarR_2 LexA_DNA_bind HTH_IclR DUF4032
Motif
Other DBs
NCBI-ProteinID: ABY30313
UniProt: A9W407
Position
2131177..2131494
Genome map
AA seq 105 aa AA seqDB search
MNVEQAAKQLESLGSPARLRIYRALVRAGHAGLPVRQLQERVGIPAASTLSHHLHRLILT
GLVTQERQATTLICRAVYPAMNALVGYLSDECCADEACSDKGEAA
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtcgaacaagccgccaagcagcttgagtccttgggcagcccggcccggctccgg
atctaccgggcccttgtccgggccggccatgcgggactgccggtgcgccagttgcaggag
cgggtcggcatccccgccgcctcgacgctgtcgcatcacctgcaccggctgatcctcacc
gggctggtcacccaggagcggcaggcgaccaccctgatctgccgtgccgtctaccccgcg
atgaacgcgctcgtcggatacctgtcggacgagtgctgcgccgacgaggcctgctccgac
aagggcgaggcagcctga

DBGET integrated database retrieval system