KEGG   Methylobacterium extorquens PA1: Mext_1920Help
Entry
Mext_1920         CDS       T00640                                 

Definition
(GenBank) TIR protein
Organism
mex  Methylobacterium extorquens PA1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIR_2 TIR DUF3391 DUF1863 TIR-like
Motif
Other DBs
NCBI-ProteinID: ABY30319
UniProt: A9W413
Position
complement(2138272..2139024)
Genome map
AA seq 250 aa AA seqDB search
MRARARTHTEKPGPTSKTAAKAKPGPRSPARPAVPRPKPEKPEVRIFVSYSHRDADARQR
LETHLAPLKREGVTTWFDGDMNAGDKLDTGIARALRNAHVFVGLLSPDYLASNYCWKIEY
KRAMGRRANGTMRVVAVVLRPCDWKSTTAAGFKLLPEDGKEVTRWRSADDAFLNVAQGIR
RVVADVRKTMAAAPPKPAPRKPAASKAAAQPPTKPGPKPRQKPGPKPNPGRAGAGAVARK
RKPPAKGRKP
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcccgcgcccgcacgcacaccgagaagcccggccccacgtccaagacggcggcc
aaggcgaagcctggaccgcgctccccggccaggccggcggtcccgcgcccgaagccggag
aagcccgaggtccggatcttcgtctcgtactcgcaccgggacgccgacgcccgccagcgg
ctggagacccacctcgcgcccctgaagcgcgagggcgtcacgacctggttcgacggcgac
atgaacgccggcgacaagctcgacaccgggatcgcgcgggcgctgcgcaacgcccacgtc
ttcgtcggcctgctcagccccgactacctcgcgagcaactactgctggaagatcgagtac
aagcgcgccatgggccgccgcgcgaacggcacgatgcgcgtcgtcgcggtcgtgctgcgc
ccctgcgactggaaatcgaccaccgcggccggtttcaagctgctgccggaggacggcaag
gaggtcacccgctggcgcagcgccgacgacgccttcctcaacgtcgcccagggcatccgg
cgcgtggtcgccgacgtccgcaagaccatggccgcggcgccacccaagccagccccgagg
aagccggccgcctcgaaagctgcggcgcagccgccgaccaagcccggcccgaagcctcgc
cagaagccgggcccgaagcccaacccaggtcgcgcaggcgcaggagcggtcgcaaggaag
cgcaagccgccggccaaggggcgcaaaccctga

DBGET integrated database retrieval system