KEGG   Methylorubrum extorquens PA1: Mext_1922Help
Entry
Mext_1922         CDS       T00640                                 

Definition
(GenBank) metallophosphoesterase
Organism
mex  Methylorubrum extorquens PA1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Metallophos Metallophos_2
Motif
Other DBs
NCBI-ProteinID: ABY30321
UniProt: A9W415
Position
complement(2139528..2140079)
Genome map
AA seq 183 aa AA seqDB search
MPNTFFTSDSHFGHASVLAPRMDRPRPFATIAEHDEALIAAWNAVVRPGDIVWHLGDFAY
RCDLAYAASIKARLNGRIRLIRGNHEELGGQLDWDKPVVDVQRVFVQDPGMPKPQAIWCS
HYAHRTWPHERHGDLHLYGHSHGSLPGTRTSLDVGVDCWDWAPVRLDEILKRMAATPEPV
PAA
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgcctaacacgttcttcaccagcgacagccatttcgggcacgcctcggttctggcgccg
aggatggaccgaccccgccccttcgccaccatcgcggagcacgacgaggccctgatcgcg
gcctggaacgcggtcgtcaggcccggcgacatcgtctggcacctcggggatttcgcttac
cggtgcgacctcgcttacgcggcttcgatcaaggcacggctgaatgggcgcatccgcctg
atccgcggcaaccacgaggagctcggcgggcaactcgactgggacaagccggtcgtcgac
gtgcagcgcgtcttcgtccaggatccaggcatgcccaagccccaggcaatctggtgcagc
cactacgcccaccggacctggccgcacgaacggcacggcgacctgcacctctacgggcat
tcgcacggcagcctgcccggcacccgcaccagcctcgacgtgggcgtcgattgctgggat
tgggcccccgtgcggttagatgagatcctgaagcgcatggccgcgaccccagagcccgtc
ccagccgcctga

DBGET integrated database retrieval system