KEGG   Methylobacterium extorquens PA1: Mext_1926Help
Entry
Mext_1926         CDS       T00640                                 

Definition
(GenBank) ATP-binding region ATPase domain protein
Organism
mex  Methylobacterium extorquens PA1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c Response_reg HisKA KR LPP
Motif
Other DBs
NCBI-ProteinID: ABY30325
UniProt: A9W419
Position
2143504..2144868
Genome map
AA seq 454 aa AA seqDB search
MNRPGLWMEPPAEPQTIEALTHRVAKLERINAALMAHVERTMDQQGGAYSLFQTAIMLEG
RVRARTEELTALMNSLERSNAAMQAAKEEAETANRSKTRFLAAASHDLLQPLNAARLSLS
ALTDLAPGPEAQGIARQVERGLETIEDLIKALIDISKLDAGIVRPVIKPVRLADLVAGIE
ASFRPFAERKELRLVTRCADLVVETDGILLQRILQNLVSNAIRYTESGGVLIAARRRDKL
CRIDVVDTGCGIPEAERALVFEEFFRGARECDDGGIGLGLGLSIVQRMASTLGHAIELHS
RSGHGTRLSLTLPLATQRPDPRVTLAPLATALTGARVLAIENDASTAEALQRLLRNWDAE
VQVFRDLAGVVAALGAGLARPDVMVIDYHLDNGACGLDVVDYLRRNRGWVTPVILTTADH
GADIAARAQATGAELVHKPIKPAQLRSLLAYMLA
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgcccaggcctctggatggaaccgcccgccgaaccgcagacgatcgaggccctg
acgcatcgggtggccaagctcgagcgcatcaacgcggcgctgatggcccatgtcgagcgc
accatggatcagcagggcggcgcttactcgctgttccagaccgcgatcatgctggagggc
cgcgtccgcgcccgcaccgaagagctgaccgcgctgatgaacagcctggagcgctcgaac
gcggcgatgcaggccgccaaggaagaggccgagaccgccaaccgctcgaagacgcgcttc
ctggccgcggccagccacgatctgctccaaccgctcaacgccgcccgcctctcgctctcg
gcgctgaccgacctcgcgccggggccggaagcgcaggggatcgcccggcaggtcgagcgc
ggcctggagacgatcgaagacctgatcaaggcgctcatcgacatctcgaagctcgatgcc
ggcatcgtgcgccccgtgatcaagccggtgcggctcgccgatctcgtggccgggatcgag
gccagcttccggcccttcgccgagcgcaaggagctgcgcctcgtcacccgctgcgccgac
ctcgtggtggagaccgacgggatcctgctccagcgcatccttcagaacctcgtctcgaac
gcgatccgctacaccgagagcggcggcgtgctgatcgcagcgcgtcggcgggacaagctc
tgccggatcgacgtggtcgataccggctgcggcatacccgaggctgagcgggccctggtc
ttcgaggagttctttcgcggcgcgcgcgagtgcgacgatggcgggatcggcctcgggctc
ggcctgtcgatcgtgcagcgcatggcctcgaccctggggcatgccatcgaactgcattcc
cgcagtggtcacggcacacggctgagcctcaccctgccgctcgccacccagcgtccggat
ccgcgggtgaccctcgctcccttggcgacggcgctgacgggcgcgcgggttctggcgatc
gagaacgacgcctccacggcggaggcgctgcagcggctcctgcgcaactgggatgccgag
gtgcaggtgtttcgcgatctcgcgggcgtcgtggctgccctcggtgccggtctggcacgg
ccggatgtgatggtgatcgactatcacctcgacaacggcgcctgcggcctcgacgtggtg
gattacctgcggcgcaaccggggctgggtgacgccggtgatcctcaccaccgccgaccac
ggcgccgacatcgccgcccgcgcccaggccaccggggccgaactcgtccacaagccgatc
aagccggcgcaactgcgctcgctgctcgcctacatgctggcgtga

DBGET integrated database retrieval system