KEGG   Methylorubrum extorquens PA1: Mext_1929Help
Entry
Mext_1929         CDS       T00640                                 

Definition
(GenBank) thioesterase superfamily protein
  KO
K10806  acyl-CoA thioesterase YciA [EC:3.1.2.-]
Organism
mex  Methylorubrum extorquens PA1
Pathway
mex01040  Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:mex00001]
 09100 Metabolism
  09103 Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Mext_1929
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mex01004]
    Mext_1929
Enzymes [BR:mex01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Mext_1929
Lipid biosynthesis proteins [BR:mex01004]
 Fatty acid synthase
  Component type
   Mext_1929
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 4HBT 4HBT_3 MaoC_dehydratas 4HBT_2
Motif
Other DBs
NCBI-ProteinID: ABY30328
UniProt: A9W422
Position
2146439..2146858
Genome map
AA seq 139 aa AA seqDB search
MTSELPSAEPVPPTDRGQAVIRTVAMPTDTNPAGDIFGGWLMAQMDMAAGNVAARRARGR
CATISAEAMTFHRPVFVGDEVSFYAWIVKTGRTSMRIQVEVWRREREGEATMKVTEGLFT
FVAIGPDRRPRPIPEEREV
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgacaagcgaactgccttccgccgagcccgtgccgcccaccgaccgtgggcaggcggtg
atccgcaccgtggcgatgcccaccgatacgaacccggccggcgacatcttcggcggctgg
ctgatggcgcagatggacatggccgccggcaacgtcgccgcccgccgggcacgggggcgc
tgcgccacgatctcggcggaggcgatgaccttccaccgcccggtcttcgtcggcgacgag
gtgagcttttatgcctggatcgtgaagacgggccgcacctcgatgcgcatccaggtcgag
gtctggcgccgggagcgggagggcgaggccaccatgaaggtgacggagggcctcttcacc
ttcgtcgccatcgggccggatcgccggccgcggccgatcccggaggagcgggaggtctga

DBGET integrated database retrieval system