KEGG   Methylobacterium extorquens PA1: Mext_1932Help
Entry
Mext_1932         CDS       T00640                                 

Definition
(GenBank) molybdopterin oxidoreductase
Organism
mex  Methylobacterium extorquens PA1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Molybdopterin Molydop_binding Molybdop_Fe4S4
Motif
Other DBs
NCBI-ProteinID: ABY30331
UniProt: A9W425
Position
2149016..2151196
Genome map
AA seq 726 aa AA seqDB search
MLEERISEIDAEAAAMSVSEAVTRLGACPHDCPDTCSMIYTVENGRLIDVRGNLDHPMTR
GALCGKLKDFDRHHYNPDRILYPMRRTGPKGSGQFERITWDEALAEIHRRFTGIIETHGA
EAILPYNYLGNEGVVQGLTVGDAFFNRLGATVAEKTFCGSGSCTAWLLTVGPTNGTDPMS
FAQSKLIVIWGCNSVSTNIHHWHVVKEAQRHGARVIVIDPYRSRTAAQADWHLMPKPGTD
GALAMAMIHVIIEEGLTDDDYIARHTVGFEPLKERAQAFTPEYAAEICGIPAEDIRQLAR
EYATTRNAALRPGVAVERSAGGAQALRAIFSLPALTGSWKDPGGGVYQMPLWEFPVHWDR
VCRPDLIPEGTRVLNVLKLGEVLTGEAGIEPGIHALMVYNANPVSNSTETAKIKRGLARE
DLFTVVSEHFVTDTARYADILLPATMAAEHDDMMFSWGHFFFTLNQKAIEPPGETVANAE
LFRRLAKTFGFTEPQFSMSETELMEWYLDWESPKLGGIGMDHFRQHGWYRLNIGDPDTRT
PHAEGNFPTPSGKCEFYSEAAVTSGNFVAPPFRQMYEQFQGGEALDPLPGYVPANERPET
NPAQAERYPLNIVSPKSHGFLNSQYANEAHKVRAQGEQTILINPADAQSREIGEGALVRV
FNDRGAFHGQARVTEEVPPGLVIASLGYWHSLNRDGAVNVISASTYGGMGHSPTFSDNLV
QVGLAL
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atgctcgaagagcgcatctcggagatcgatgccgaggcggctgcaatgtccgtttccgaa
gccgtcacccggctcggcgcctgcccgcacgactgccccgacacctgttcgatgatctac
accgtcgagaacgggcggctgatcgacgtgcgcggcaacctggatcatccgatgacccgc
ggcgcgctctgcggcaagctcaaggacttcgaccgccaccattacaaccccgaccgcatc
ctctacccgatgcgccggaccggcccgaagggcagcggtcagttcgagcggatcacctgg
gatgaggcgctcgccgagatccaccgccgcttcaccggcatcatcgagacgcacggggcg
gaggcgatccttccctacaactatctcggcaacgagggcgtggtgcagggcctcaccgtg
ggcgacgccttcttcaaccggctcggcgcgacggtcgccgagaagacgttctgcggctcg
ggctcctgcaccgcgtggctgctgaccgtcggcccgaccaacggcaccgacccgatgagc
ttcgcgcagtcgaagctcatcgtgatctggggctgcaactcggtctcgaccaacattcac
cactggcacgtggtgaaggaggcgcagcgccacggcgcccgcgtcatcgtgatcgacccc
tatcgctcgcgcaccgccgcccaggccgactggcacctgatgccgaaacccggcaccgac
ggcgcgctcgccatggcgatgatccacgtcatcatcgaagagggcctgaccgacgacgat
tacatcgcccgccacaccgtcggcttcgagccgctgaaggaacgggcgcaggccttcacg
ccggaatacgcggccgagatctgcggcatcccggccgaggatatccggcagcttgcgcgc
gaatacgccaccacccgcaacgcggcgctgcggcccggcgtggcggtggagcggagtgcc
ggcggcgcccaggcgctgcgggcgatcttctcgcttcccgccctgacggggtcgtggaag
gatccgggcggcggcgtctaccagatgccgctgtgggagtttccggtgcactgggaccgg
gtctgccggccggacctgatcccggagggcacgcgggtgctcaacgtgctgaagctcggc
gaggtgctgaccggcgaggcggggatcgagcccggcatccacgccctgatggtctacaac
gccaacccggtttcgaactcgaccgagaccgccaagatcaagcgcgggctcgcccgcgag
gatctgttcacggttgtcagcgagcacttcgtcacggacaccgcccgctacgccgacatc
ctgctgccggccaccatggcggccgagcacgacgacatgatgttctcctgggggcacttc
ttcttcaccctgaaccagaaggcgattgagccgccgggcgagacggtggcgaatgccgag
ctgttccggcggctggccaagaccttcggtttcaccgagccccagttctccatgagcgag
accgagctcatggaatggtatctcgattgggagagcccgaagctcggcggcatcggcatg
gaccatttccgccagcacggctggtaccgcctgaacatcggcgatccggacacgcgcacc
ccccacgccgagggcaacttcccgacgccgtccggcaagtgcgagttctactcggaggcg
gccgtcacgagcggcaacttcgtcgcgccgcccttccggcagatgtacgagcagttccag
ggcggcgaggccctcgatccgctgccgggctacgtgccggccaacgaacgtccggagacg
aatccggcccaagccgagcgctacccgctcaacatcgtctcgcccaagagccacggcttc
ctcaactcgcaatacgccaacgaggcgcacaaggtccgcgcgcagggcgagcagacgatc
ctgatcaacccggccgacgcgcagagccgcgagatcggcgagggcgcgctggtgcgggtg
ttcaacgaccgcggcgccttccacgggcaggcgcgggtgaccgaggaggtgccgccgggc
ctcgtgatcgcctcgctcggctactggcactcgctcaaccgcgacggggcggtgaacgtc
atcagcgcctcgacctatggcggcatgggccactcgccgaccttcagcgacaacctcgtg
caggtcgggctggcactgtag

DBGET integrated database retrieval system