KEGG   Methylobacterium extorquens PA1: Mext_1934Help
Entry
Mext_1934         CDS       T00640                                 

Definition
(GenBank) phosphopentomutase
  KO
K01839  phosphopentomutase [EC:5.4.2.7]
Organism
mex  Methylobacterium extorquens PA1
Pathway
mex00030  Pentose phosphate pathway
mex00230  Purine metabolism
Brite
KEGG Orthology (KO) [BR:mex00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Mext_1934
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Mext_1934
Enzymes [BR:mex01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.7  phosphopentomutase
     Mext_1934
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Metalloenzyme
Motif
Other DBs
NCBI-ProteinID: ABY30333
UniProt: A9W427
Position
2152935..2154155
Genome map
AA seq 406 aa AA seqDB search
MARALLIVLDSVGIGGAPDADRYGDAGSDTVGHIAEACAAGRGDRPGLRAGPLHLPNLAA
LGLGLACEGATGRVPPGLAPEGPVRALWGHAVETAAGKDTPSGHWEIAGVPVREAWGHFP
DTQPAFPAELTAALVARAGLPGILGDCHASGTAIIEALGAEHVRTGKPICYTSADSVFQI
AAHEEAFGLERLYETCRIAREVCDPYRVGRVIARPFLGSAAEGFRRTSHRKDFSVAPPAG
TLLDGLETAGRAVVSVGKIGDIFAHRATGREIKPAGNAACLDAALDAFAGLPEGGFVFLN
LVDFDTEHGHRRDVPGYAAELEAFDRRLPEIQAVLKPGDLCVITADHGNDPTWTGTEHTR
EQVPVLAFGPGLAPRALGRRESFADMGASVAAHLGLPPLGAGQAWW
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atggcccgtgccctcctcatcgtcctcgattccgtcggcatcggcggcgctccggacgcc
gaccgctatggcgatgccggctccgacacggtcggccacatcgcggaggcttgcgccgcc
ggacgcggcgaccggccgggcctgcgcgccggacccttgcacttgccgaacctcgctgcg
ctcggcctcgggctggcctgcgaaggcgccaccgggcgcgtcccgccggggcttgcgccc
gagggacccgtgcgggcgctctggggccacgccgtcgagaccgccgcgggtaaggacacc
ccgtcaggccattgggagatcgcaggcgtgccggtgcgggaggcctggggccacttcccc
gatacgcagcccgccttccccgcggagttgacggcggcgctggtcgcacgggccgggctg
ccgggcatcctcggcgattgccacgcctccggcaccgcgatcatcgaggcgcttggggcc
gagcatgtccggacgggcaagccgatctgctacacctcggccgacagcgtgttccagatc
gccgcccacgaggaggcgttcggactggagcggctctacgagacctgccggatcgcccgc
gaggtctgcgatccctaccgcgtcggccgggtcatcgcccgacccttcctcggcagcgcg
gcggaaggcttccgccgcaccagccaccgcaaggacttttcggtggcgccccccgccggg
acgctgctggacgggctggagactgcgggccgcgcggtcgtgagcgtcggcaagatcggc
gacatcttcgcccaccgcgccaccggccgcgagatcaagcccgccggaaacgccgcctgc
ctcgacgcggcgctcgacgccttcgccggattgccggagggcggcttcgtcttcctcaac
cttgtggatttcgacaccgagcatggccaccgccgcgacgtgccgggctacgccgccgag
ctggaagccttcgacaggcgcctgcccgagatccaggcggtgctgaagccgggcgacctc
tgcgtgatcaccgccgaccacggcaacgacccgacctggacgggcacggagcacacccgc
gagcaggtgccggtgctggccttcgggccggggctggcgccgcgcgctctcggccgccgg
gaaagctttgccgatatgggcgcctcggtggcggcccatctcggcctgccgccgctcggg
gccgggcaggcgtggtggtga

DBGET integrated database retrieval system