KEGG   Methylobacterium extorquens PA1: Mext_1936Help
Entry
Mext_1936         CDS       T00640                                 

Definition
(GenBank) conserved hypothetical protein
Organism
mex  Methylobacterium extorquens PA1
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABY30335
UniProt: A9W429
Position
complement(2156332..2156610)
Genome map
AA seq 92 aa AA seqDB search
MPRRKADPALPFRPFAEDAGVQTFAGFSIENGTRRIALHGSLDLTRDRAGLKRARALKSL
LDAVVATLEAEDLPDAVPEEPETAEPVRNPFA
NT seq 279 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgccgcaaagccgatcccgccctccccttccgccccttcgcggaggatgcgggc
gtccagaccttcgccggcttctccatcgagaacggcacgcgccgcatcgccctgcatggc
agcctcgacctcacccgcgaccgggcgggtttgaagcgtgcgagggcgttgaagagcctg
ctcgatgcggtggttgccaccctcgaagcggaggatctgcccgatgccgtgcccgaggag
ccggagacggccgagccggtgcgcaaccctttcgcctga

DBGET integrated database retrieval system