KEGG   Methylobacterium extorquens PA1: Mext_1937Help
Entry
Mext_1937         CDS       T00640                                 

Definition
(GenBank) DNA/RNA non-specific endonuclease
  KO
K01173  endonuclease G, mitochondrial
Organism
mex  Methylobacterium extorquens PA1
Brite
Mitochondrial biogenesis [BR:mex03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA replication factors
   Mitochondrial DNA maintenance factors
    Mext_1937
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Endonuclease_NS Endonuclea_NS_2
Motif
Other DBs
NCBI-ProteinID: ABY30336
UniProt: A9W430
Position
complement(2156621..2157514)
Genome map
AA seq 297 aa AA seqDB search
MALRPLVPALLLVVVPHAALSQALPEPQALPEAPACRALFADGRAPTLTNPKLADRAVPL
CFEAFAVLHSGVSRTPLYAAERLTRRSVSAARRVERADAFHDEDRLPEDDRASLADYLRS
GYDRGHLAPAGDMPSAVAQGESFSLANIVPQNRAVNRGLWAAIEESVRRLASERGEIFVV
TGPIFEGRSVGAIKGRVLVPTQMFKAIYDPRTGEAGAYLVPNAAGAEWRAVSLATLRETA
GLDVFPALPEASKAKAMALPEPQEFSRGGPESFADFLKQLVVDVLRRLWRELMRAIF
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgcgtccgctcgttccggcccttctccttgtcgtcgtcccgcacgcggctttg
tcccaagccctgccggagccccaggctctgccggaggcgccggcctgccgcgccctgttc
gcggacggccgggcgccgacgctcaccaacccgaagctcgccgaccgagccgtcccgctc
tgcttcgaggccttcgccgtgctccattcgggcgtgtcgcgcacgccgctctacgccgcc
gagcgactgacgcgccggagcgtgtccgccgcccgccgggtcgagcgcgccgacgccttc
cacgacgaggaccgcctgcccgaggacgaccgcgcgagcctcgccgactacctgcggagc
ggctacgaccgcggccatctggccccggccggcgacatgccgagcgcggtcgcccagggc
gaatccttcagcctcgccaacatcgtgccgcagaaccgggcggtgaaccgcggcctgtgg
gcggcgatcgaggagagcgtgcgccggctcgccagcgagcgcggcgagatcttcgtcgtg
actggcccgatcttcgagggccgctcggtcggcgcgatcaaggggcgggtgctggtgccg
acccagatgttcaaggcgatctacgatccgcgcaccggcgaggccggggcctatctcgtg
ccgaatgcagccggcgcggaatggcgcgcggtctcactcgcgaccctgcgggagacggcg
gggctcgacgtgttcccggctttgcccgaggcgagcaaggccaaggcgatggcgctgccc
gagccgcaggaattctcccgcggcggcccggaatccttcgccgacttcctcaagcaactg
gtcgtcgatgtcctgcgccggctctggcgcgagctgatgcgcgcgatcttctga

DBGET integrated database retrieval system