KEGG   Methylobacterium extorquens PA1: Mext_1939Help
Entry
Mext_1939         CDS       T00640                                 

Definition
(GenBank) deoxyxylulose-5-phosphate synthase
  KO
K01662  1-deoxy-D-xylulose-5-phosphate synthase [EC:2.2.1.7]
Organism
mex  Methylobacterium extorquens PA1
Pathway
mex00730  Thiamine metabolism
mex00900  Terpenoid backbone biosynthesis
mex01100  Metabolic pathways
mex01110  Biosynthesis of secondary metabolites
mex01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mex00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    Mext_1939
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Mext_1939
Enzymes [BR:mex01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.7  1-deoxy-D-xylulose-5-phosphate synthase
     Mext_1939
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_synthase_N Transket_pyr Transketolase_C Transketolase_N TPP_enzyme_C E1_dh
Motif
Other DBs
NCBI-ProteinID: ABY30338
UniProt: A9W432
Position
2158109..2160082
Genome map
AA seq 657 aa AA seqDB search
MALADTTILEGLETPDRLRLLPESELQRVADAVRAEMIDAVSITGGHLGSGLGVVELTVA
LHHVFDTPDDRIVWDVGHQCYPHKILTGRRDRIRTLRQGGGLSGFTKRSESEYDPFGAAH
SSTSISAALGMAVARDLEEADAKAKGGPAPKRRNMIAVIGDGSMSAGMAYEAMNNAGALH
SRLIVILNDNDMSIAPPVGAMSAYLARLASGGTYRSLRETAKQLGKLLPKALYQRAAAAE
EYARSLIVGGGTMFEEMGFHYVGPVDGHNLDHLLPVLKNVRDSDQGPILLHVVTQKGKGY
APAEASADRYHGVVKFDVVSGVQAKAKANAPAYTRVFGESLIKAADADPKVVAITAAMPG
GTGIDLFGKAHPDRTFDVGIAEQHAVTFAGGLATEGYKPFVAIYSTFLQRAYDQVVHDVA
LQNLAVRFCLDRAGLVGADGATHAGAFDLAYLCCLPNMTVMAAADEAELVHMVATCHAHD
SGPIALRYPRGEGVGIELPETGVPLAIGRGRVVRRPEGARVALLSLGTRLSEALKAADAL
EAEGVAATVADARFAKPLDAELIVDLAMSHEVLVTVEEGSVGGFGAMVLHLLAERGVLDT
GRVRVRTLTLPDLYQDHDKPEKMYAEAGLDAEGILKAVRAALPDQKKGSRTGRLRLA
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
ttggcactagcggacacgacgatccttgagggtcttgagacgccggatcgtctccggctt
ctgccggagagcgagctgcagcgggtcgccgacgcggtgcgcgccgagatgatcgacgcc
gtgtcgatcaccggcggccatctcggctcgggcctgggcgtggtcgaactcacggtggcg
ctccaccacgtcttcgacacccccgacgaccgcatcgtctgggacgtcggacaccagtgc
tacccgcacaagatcctcacaggccgccgcgaccgcatccgcacgctgcgccagggcggc
gggctgtccggcttcaccaagcggtcggagagcgagtacgacccgttcggcgcggcccac
tcctccacctcgatctccgccgcgctcggcatggccgtggcacgcgacctcgaggaggcg
gacgccaaggccaagggcggcccggcgcccaaacgccgcaacatgatcgcggtgatcggc
gacggctcgatgtcggcgggcatggcctacgaggccatgaacaatgccggcgccctgcac
tcgcgcctcatcgtcatcctcaacgacaacgacatgtcgatcgcgccccccgtcggcgcg
atgtcggcctacctcgcccggctcgcctccggcggcacctatcgctcactgcgcgagacc
gccaagcagctcggcaagctgctgccgaaggcgctctaccagcgcgcggccgccgcggag
gagtatgcccgctcgctgatcgtcggcggcggcacgatgttcgaggagatgggcttccac
tatgtcggcccggtcgatgggcacaatctcgaccacctgctccccgttctgaagaacgtg
cgcgactcggatcagggcccgatcctgctccatgtcgtcacgcagaagggcaagggctac
gccccggcggaggcatccgccgaccgctaccacggcgtggtcaagttcgacgtggtttcg
ggcgtgcaggccaaggccaaggccaacgccccggcctatacccgcgtgttcggcgagagc
ctgatcaaggcggccgacgccgacccgaaggtggtggcgatcaccgcggcgatgcccggc
ggcaccgggatcgacctgttcggcaaggcgcatcccgaccggaccttcgacgtcggcatc
gccgagcagcacgcggtaacctttgctggcggcttggctaccgagggctacaagccgttt
gtggcgatctactcgaccttcctgcagcgggcctacgatcaggtcgtgcacgatgtcgcg
ctgcagaacttagccgtgcggttctgcctcgaccgggcgggactggtgggcgcggacggc
gccacgcatgcgggcgcgttcgatctggcctatctctgctgcctgccgaacatgacggtg
atggcggcggccgacgaggccgagctggtgcatatggtggcgacctgccacgcgcacgat
tcgggtccgatcgcgctgcgctacccgcgcggcgagggggtcgggatcgagctgccggag
acgggcgtgccgctggcgatcggccgcggccgcgtggtgcggcgtccggaaggggcgcgg
gtggcgctgctctcgctcggcacgcggttgtcggaggcgctgaaggcagccgacgcgctg
gaggccgagggggtggcggccacggtcgcggatgcgcgctttgccaagccgctggatgcc
gagctgatcgtcgatctggcgatgagccacgaggttctggtgacggtcgaggaaggctcg
gtcggcggcttcggggcgatggtgctgcacctgctggccgagcgcggcgtgctcgatacc
ggccgggtccgggtccgcacgctgacgctgccggacttgtaccaggaccacgacaagccg
gagaagatgtacgccgaggccgggctcgatgccgagggcatcctcaaggccgtccgcgcc
gcgctgccggaccagaagaagggcagccggaccgggcgcctgcgtctggcttga

DBGET integrated database retrieval system