KEGG   Methylorubrum extorquens PA1: Mext_1966Help
Entry
Mext_1966         CDS       T00640                                 

Definition
(GenBank) fructose-1,6-bisphosphatase, class II
  KO
K11532  fructose-1,6-bisphosphatase II / sedoheptulose-1,7-bisphosphatase [EC:3.1.3.11 3.1.3.37]
Organism
mex  Methylorubrum extorquens PA1
Pathway
mex00010  Glycolysis / Gluconeogenesis
mex00030  Pentose phosphate pathway
mex00051  Fructose and mannose metabolism
mex00680  Methane metabolism
mex01100  Metabolic pathways
mex01110  Biosynthesis of secondary metabolites
mex01120  Microbial metabolism in diverse environments
mex01130  Biosynthesis of antibiotics
mex01200  Carbon metabolism
Module
mex_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
mex_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
Brite
KEGG Orthology (KO) [BR:mex00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mext_1966
   00030 Pentose phosphate pathway
    Mext_1966
   00051 Fructose and mannose metabolism
    Mext_1966
  09102 Energy metabolism
   00680 Methane metabolism
    Mext_1966
Enzymes [BR:mex01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Mext_1966
    3.1.3.37  sedoheptulose-bisphosphatase
     Mext_1966
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_glpX DUF4072
Motif
Other DBs
NCBI-ProteinID: ABY30365
UniProt: A9W459
Position
complement(2197894..2198889)
Genome map
AA seq 331 aa AA seqDB search
MSAANSGIFSDPTARGLTLELVRVTEAAAIAAARLRGHGREKEADQAAVDAMRAELMLLP
IEGRVVIGEGERDEAPMLFIGEAVGTGNGPSVDIAVDPLEGTTLCAKDMPGAIAVMALAE
RGSLLAAPDVYMQKIAIGPGYPLGTVDLDWSPARNIASLARAKGVETSGITAIILDRPRH
MDLIAAVRDTGASIRLISDGDIAAIIHCTKPDETGVDIYMGTGAAPEGVIAASALRCIGG
QMQGRLILDSADKRARAVKMGITDPNRKYDMHDMARGDVIVAATGVTTGALLAGVRFSPG
LIETETVVYRSNTGTVRRIACEHRRLESAPG
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcggccaattccgggatcttcagcgatcccacggcgcggggcctgaccctcgaa
ctggtgcgggtgaccgaggcggcggccatcgccgcggcccggctgcggggccacggccgc
gagaaggaggccgaccaagccgccgtcgatgcgatgcgcgccgagctgatgctgctgccg
atcgagggccgcgtggtgatcggcgagggcgagcgcgacgaggcgccgatgctgttcatc
ggcgaggccgtcggcaccggaaacggcccgtccgtggacatcgcggtcgatccgctggag
ggcacgacgctctgcgccaaggacatgcccggcgccatcgccgtgatggccctggccgag
cgcggctcgctgctcgccgcccccgacgtctacatgcagaagatcgccatcggccccggc
tacccgctcggcacggtcgatctcgattggagcccggcccggaacatcgcttcgctcgcc
cgcgccaagggcgtggagacctccggcatcaccgcgatcatcctcgaccggccgcgccac
atggacctgatcgccgccgtgcgcgacaccggcgccagcatccgcctgatctcggacggc
gacattgccgcgatcatccactgcaccaagcccgacgagaccggcgtcgatatctacatg
ggcaccggcgccgcgccggagggcgtgatcgccgccagcgcgctccgctgcatcggcggc
cagatgcaggggcgtctcatcctcgattccgccgacaagcgggcacgggcggtcaagatg
ggcatcaccgacccgaaccggaaatacgacatgcacgacatggcccggggcgacgtcatc
gtcgcggccaccggcgtgaccacgggggccctgcttgcgggcgtgcggttcagccccggc
ctgatcgagacggagacggtggtctaccgctcgaacaccggcaccgtccgccgcatcgcc
tgcgaacaccgccggctggagagcgcgccgggctga

DBGET integrated database retrieval system