KEGG   Methylobacterium extorquens PA1: Mext_2265Help
Entry
Mext_2265         CDS       T00640                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
mex  Methylobacterium extorquens PA1
Pathway
mex00790  Folate biosynthesis
mex01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mex00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Mext_2265
Enzymes [BR:mex01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Mext_2265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: ABY30660
UniProt: A9W504
Position
complement(2511728..2512537)
Genome map
AA seq 269 aa AA seqDB search
MYAKPDSTTLKARLAKAGDAMDAALKSLSYGMSDDERRMSAVGLQGMRGANDPGRPDITP
DIAPLPESAQRVPNEVALGRPSRQEAEAAVRTLLRWAGDDPTREGLIETPARVVKAYEQI
FGGYRADADALLERVFEEVEGYSDAVLVRDIPFYSHCEHHMVPFMGLAHIAYYPTKGVVG
LSKLARVVDAFARRLQTQETMTAQIADTIESILQPRGCAVMIEAEHLCMAMRGVQKAGVS
TITTQFRGVYKNDASEQVRFLTFVRNQKG
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgtacgccaagcccgacagcaccaccctgaaggcgcgtttggcgaaggccggagatgcc
atggatgccgctctcaaatccctgtcctacggcatgagcgacgacgaacgacgcatgagt
gccgtgggcctgcaaggaatgcgcggcgccaacgatccgggccgtcccgacatcaccccc
gacatcgcgcccctgcccgaatcggcccagcgggtgccgaacgaggtggcgctcggccgt
ccgagccggcaggaggcggaggccgccgtgcgcacgcttctgcgctgggccggcgacgac
ccgacccgcgaagggctgatcgagacccccgcccgcgtggtgaaggcctacgagcagatt
ttcggcggctatcgcgccgacgccgacgcgctgctggagcgggtgttcgaggaggtcgag
ggctattccgacgccgtgctggtgcgcgacatcccgttctactcccattgcgagcaccac
atggtgccgttcatggggttggcccacatcgcctactaccccaccaagggcgtggtcggc
ctctccaagctcgcccgcgtggtcgatgccttcgcccgtcgcctgcagacgcaggagacc
atgacggcgcagatcgccgacacgatcgagagcatccttcagccccgcggctgcgccgtg
atgatcgaggccgagcatctctgcatggcgatgcgcggcgtgcagaaggccggcgtctcc
accatcaccacgcagttccgcggcgtctacaagaacgatgcgtccgagcaggtccgcttc
ctgaccttcgttcggaaccagaagggttga

DBGET integrated database retrieval system