KEGG   Methylobacterium extorquens PA1: Mext_2392Help
Entry
Mext_2392         CDS       T00640                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
mex  Methylobacterium extorquens PA1
Pathway
mex00521  Streptomycin biosynthesis
mex00523  Polyketide sugar unit biosynthesis
mex01130  Biosynthesis of antibiotics
Module
mex_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:mex00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Mext_2392
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Mext_2392
Enzymes [BR:mex01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Mext_2392
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: ABY30787
UniProt: A9W5D1
Position
2644653..2645204
Genome map
AA seq 183 aa AA seqDB search
MQVIDTEIPAVKRVIPKRHGDDRGWFSEVYRADLLAERGIANAFVQDNQSFSAPAGTIRG
LHFQVAPNAQAKLIRVLAGAILDVAVDLRSNSSSYGRHVAVRLDATGGEQLFVPAGFAHG
FCTLEPDSMVAYKVDAYYSPADDRNLRWNDPAIGIAWPVAEADAILSGKDKAAPLLADLG
RVF
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtcatcgatactgaaattccggcggtcaagcgggtgatcccgaagcgccacggc
gacgatcgcggctggttctcggaagtctaccgagccgacctgctggccgaacgcggcatc
gccaatgccttcgtgcaggacaatcagtccttctccgcgcctgccggcacgatccggggg
ctgcacttccaggtggcgcccaacgcccaggccaagctgatccgggtgctcgccggcgcg
atcctcgatgtcgccgtcgatctgcgctccaactcctcgagctacggccgccacgtcgcc
gtgcggctcgatgcaacgggcggcgaacagctcttcgtgcccgccggctttgcccatggc
ttctgcaccctggagccggacagcatggtcgcctacaaggtcgacgcctattacagcccg
gccgacgaccggaacctgcgctggaacgatccggcgatcggcatcgcgtggccggtggcc
gaagcggatgcgatcctctcgggcaaggacaaggccgcgccgcttctggccgatctcggg
cgggtgttctga

DBGET integrated database retrieval system