KEGG   Methylorubrum extorquens PA1: Mext_2523Help
Entry
Mext_2523         CDS       T00640                                 

Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
mex  Methylorubrum extorquens PA1
Pathway
mex00030  Pentose phosphate pathway
mex00480  Glutathione metabolism
mex01100  Metabolic pathways
mex01110  Biosynthesis of secondary metabolites
mex01120  Microbial metabolism in diverse environments
mex01200  Carbon metabolism
Module
mex_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
mex_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:mex00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Mext_2523
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Mext_2523
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mex04147]
    Mext_2523
Enzymes [BR:mex01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     Mext_2523
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     Mext_2523
Exosome [BR:mex04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Mext_2523
  Exosomal proteins of colorectal cancer cells
   Mext_2523
  Exosomal proteins of bladder cancer cells
   Mext_2523
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: ABY30917
UniProt: A9W5R1
Position
2830431..2831939
Genome map
AA seq 502 aa AA seqDB search
MPDACVHDTPDTPKTPACTLVIFGAGGDLTKRLLMPALYNLAGGGLLDDGFSVLGVDHNP
LTDEGWRDDLTQTMESFTKDSSAEFHAERIDPRPWDFIRERLHVMQGDFSEEATFKDLAG
RLTGNVVFYLAVSARFFGPVVEGLGKAGLLKQTDDAFRRVVIEKPFGSDLASAKALNETI
LAQGDESQFYRIDHFLGKETVQSILAIRFANAMLEPIWRSEYVDHVEITAAETIGVEERG
RFYEPTGALRDMVPNHLFQLLTMVAMEPPSAFDAEIVRDEKTKLVEAIRPVTPENAVRGQ
YAAGREDGKDVPAYRDEPDVAKDSRTETYVALKLEIENERWSGVPFFLRTGKCLAERRTE
IAVHFKPTPLTLFRGADGGDLAPNVMRLRIDPAPGSATRFNVKRPGPQMHLAAIETGFCY
GDFFDPAPTVGYESLIYDCMMGDPTLFQRADTIEASWAAVDPLLKAWKDAPVCFYPAGSP
GPKEADDLLARDGRSWLPLGEK
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgcccgacgcctgcgttcacgatacgcccgacacgccgaagaccccggcctgcaccctc
gtgatcttcggtgccggcggcgacctcaccaagcgcctcctgatgccggccctctacaat
ctcgcgggcggtgggctgctcgatgacggcttttccgttctcggcgtcgatcacaacccg
ctgaccgacgagggctggcgcgacgacctcacccagaccatggaatccttcaccaaagac
tcgtccgccgagtttcatgccgagcggatcgacccgcgcccctgggacttcatccgcgag
cgcctgcacgtgatgcagggtgatttctccgaggaagcgaccttcaaggatctcgccgga
cgcctcaccggcaacgtcgtgttctacctcgcggtctccgcccgcttcttcggccccgtg
gtcgaaggcctcggcaaggccggcctgctgaagcagacggacgacgcgttccgccgcgtc
gtcatcgagaagccgttcggctctgacctcgcttccgccaaggcgctcaacgaaaccatc
ctggcgcagggcgacgagagccagttctaccggatcgaccattttctcgggaaggagacg
gttcaaagcatcctggcgatccgcttcgccaacgcgatgctggagccgatctggcgcagc
gaatacgtcgaccacgtcgagatcaccgccgccgagacgatcggtgtcgaggagcgcggc
cgcttctacgagccgacgggcgcactgcgggacatggtgcccaaccacctgttccagctt
ctcaccatggtggcgatggagccgccctctgccttcgacgccgagatcgtgcgcgacgag
aagacgaagctggtcgaggcgatccgcccggtcacgccggagaatgccgtgcgcggccag
tacgcggcgggacgtgaggacgggaaggatgtcccggcctaccgtgacgagccggacgtg
gcgaaagattcgcgcaccgaaacctacgtcgccctcaagcttgagatcgagaacgagcgc
tggtccggcgtgccgttctttctgcgcaccggcaagtgcttggccgaacggcgcaccgag
atcgcggtgcatttcaagccgacgccgctcacgctgttccgcggggcggatggcggcgac
ctcgcgccgaacgtcatgcgcctgcgcatcgacccggcgcccggctcggccacgcgcttc
aacgtgaagcggccggggccgcagatgcatctcgccgcgatcgagacgggcttctgctac
ggcgatttcttcgacccggcgcccaccgtcggctacgaaagcctgatctacgattgcatg
atgggcgacccgaccctgttccagcgcgccgacaccatcgaggcgagctgggccgccgtc
gatccgctgctcaaggcgtggaaggacgcgccggtctgcttctatccggccggcagtccc
ggcccgaaggaggcggacgatctgctcgcccgcgacgggcgctcgtggctgccgctgggg
gagaagtga

DBGET integrated database retrieval system