KEGG   Methylorubrum extorquens PA1: Mext_3053Help
Entry
Mext_3053         CDS       T00640                                 

Definition
(GenBank) Peroxiredoxin
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
mex  Methylorubrum extorquens PA1
Pathway
mex00480  Glutathione metabolism
mex00590  Arachidonic acid metabolism
mex01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mex00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    Mext_3053
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Mext_3053
Enzymes [BR:mex01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Mext_3053
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: ABY31442
UniProt: A9VWY7
Position
complement(3395305..3395799)
Genome map
AA seq 164 aa AA seqDB search
MSNLYDHVPRDARGGPHPLSQYRGKVLLVVNTASKCGFTPQYQGLETLWRRHRARGLVVL
GLPCNQFGAQEPGDAAAIEQFCSLTYDVTFPVLAKVEVNGPGADPLYVDLKREKPGLFGT
QAIKWNFTKFLIGRDGRVIGRFSPSTKPEALDGAIERALAEPGE
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacctctacgatcacgtcccacgcgacgcgcgcggcggaccgcatcccctgtcg
cagtatcgcggcaaggtgcttctggtggtcaacaccgcttcgaaatgcgggttcacgccg
cagtatcagggcttggagaccctatggcggcgccatcgtgcccgcggcctcgtggtgctc
ggcctgccctgcaaccagttcggagcacaggagccgggcgatgccgccgccatcgagcag
ttctgctcgctgacctacgacgtgacctttccggtcctcgccaaggtggaggtcaacggc
ccgggcgccgacccgctctatgtcgatctcaagcgcgagaagcccggtctgttcggcacg
caggccatcaagtggaatttcacgaaattcctgatcggccgggacggccgggtgatcggc
cgcttctccccatccacgaagcccgaggccctggacggtgcgatcgagcgggccctggcg
gagccgggcgagtag

DBGET integrated database retrieval system