KEGG   Methylorubrum extorquens PA1: Mext_3223Help
Entry
Mext_3223         CDS       T00640                                 

Definition
(GenBank) uroporphyrin-III C-methyltransferase
  KO
K02302  uroporphyrin-III C-methyltransferase / precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:2.1.1.107 1.3.1.76 4.99.1.4]
Organism
mex  Methylorubrum extorquens PA1
Pathway
mex00860  Porphyrin and chlorophyll metabolism
mex01100  Metabolic pathways
mex01110  Biosynthesis of secondary metabolites
mex01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mex00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mext_3223
Enzymes [BR:mex01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     Mext_3223
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     Mext_3223
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     Mext_3223
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TP_methylase NAD_binding_7 CysG_dimeriser Sirohm_synth_M
Motif
Other DBs
NCBI-ProteinID: ABY31610
UniProt: A9VZ18
Position
3576442..3577899
Genome map
AA seq 485 aa AA seqDB search
MSTPRQPRETRAGLEPLAVLPVFVPLQDKRAVLAGSNGGAPWKVKLLAAAGARVDVYAEE
PSEELRGVPAEIAAGSVTLHERGWTPEDLQGAAFAIGAMEDEDDCVAFVAAARAAGAIVN
AVDRPHLCDVKFGAIVNRSPLVVGISTEGAAPVFGQTVRARIEAMLPRGFKHWVAAARDW
REAVSARFHGFSERRGFWERFTDRAFAEPDRTPTDADLADLMGQAEALPLGGAVTLVGAG
PGDAELLTLKALRALRNADVILYDDLVAPEILDYARREARTMLVGKTGHGPSCRQDDINA
LMVSLAKSGKQVVRLKSGDPLVFGRAGEEIEACEAAGIPCTIVPGVSAAQGAAAALGVSL
THRDAARRLQFVTGHDRRGALPEDLNWSALADRSVTTVVYMPKRTLRVLLERAVAEGLAP
ETPALVVFNATRAKQATVAGTAADLAERVEASGLEGPALLMVGEALRQHNARSAHQDVEI
RAEAS
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgccccgccaaccccgcgaaacccgcgccggcctcgagccgctggcggtgctg
cccgtgttcgtgccgctccaggacaagcgggcggtgctcgccggctccaacggcggcgcc
ccctggaaggtgaagctgctcgccgccgccggcgcccgggtcgatgtctatgccgaggag
ccgagcgaggagctgcgcggcgtgccagccgagatcgccgccggctcggtgacgctgcac
gagcgcggctggaccccggaagacctgcagggagcggccttcgccatcggtgccatggag
gacgaggacgattgcgtcgccttcgtcgcggcggcgcgcgcggccggggccatcgtcaac
gcggtcgaccggccgcatctgtgcgacgtgaagttcggcgccatcgtcaaccgctcgccg
ctcgtcgtcggcatctcgaccgagggcgccgccccggtcttcgggcagacggtgcgggcg
cgcatcgaggcgatgctgccgcgcggcttcaagcactgggtcgcggccgcccgcgactgg
cgcgaggcggtctcggcccgcttccacggcttctccgagcggcgcggattctgggagcgc
ttcaccgaccgcgccttcgccgaaccggaccgcaccccaacggacgccgacctcgccgac
ctgatgggtcaggccgaagcgctgcccctcggcggcgccgtgaccctggtcggggccggg
ccgggcgatgccgaactgctcaccctcaaggcgctgcgggcgctgcgcaacgccgacgtg
atcctctacgacgacctcgtcgcccccgagatcctcgactatgcccgccgtgaggcccgg
accatgctggtcggcaagaccggccacggcccgtcctgccgccaggacgacatcaacgcg
ctgatggtctcgctggcgaagtccggcaagcaggtggtgcgcctgaaatccggcgatccg
ctcgtcttcggccgggccggcgaggagatcgaggcgtgcgaagccgcgggcattccctgc
accatcgttcccggcgtcagcgcggcgcagggcgcggcggccgcgctcggcgtctccctg
acccaccgcgacgcggcccggcgcctgcaattcgtcaccggccacgaccgccgcggcgca
ttgccggaggatctgaactggagcgcgctggccgaccgcagcgtcaccaccgtggtctac
atgcccaagcgcacgctgcgcgtcctgctggagcgggcggtcgccgaggggctggcgccc
gagacgccggccctcgtcgtgttcaatgcgacccgggccaagcaggcgacggtggccggc
accgccgccgacctcgccgagcgggtcgaggcctcggggctcgaaggcccggcgctgctg
atggtcggcgaggccctgcgccagcacaacgcccgcagcgcgcaccaggacgtcgagatc
cgcgcggaagcctcctga

DBGET integrated database retrieval system