KEGG   Methylobacterium extorquens PA1: Mext_3241Help
Entry
Mext_3241         CDS       T00640                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase NAD-binding
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
mex  Methylobacterium extorquens PA1
Pathway
mex00071  Fatty acid degradation
mex00280  Valine, leucine and isoleucine degradation
mex00281  Geraniol degradation
mex00310  Lysine degradation
mex00362  Benzoate degradation
mex00380  Tryptophan metabolism
mex00410  beta-Alanine metabolism
mex00640  Propanoate metabolism
mex00650  Butanoate metabolism
mex00903  Limonene and pinene degradation
mex00930  Caprolactam degradation
mex01040  Biosynthesis of unsaturated fatty acids
mex01100  Metabolic pathways
mex01110  Biosynthesis of secondary metabolites
mex01120  Microbial metabolism in diverse environments
mex01130  Biosynthesis of antibiotics
mex01200  Carbon metabolism
mex01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:mex00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Mext_3241
   00650 Butanoate metabolism
    Mext_3241
  Lipid metabolism
   00071 Fatty acid degradation
    Mext_3241
   01040 Biosynthesis of unsaturated fatty acids
    Mext_3241
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Mext_3241
   00310 Lysine degradation
    Mext_3241
   00380 Tryptophan metabolism
    Mext_3241
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Mext_3241
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Mext_3241
   00281 Geraniol degradation
    Mext_3241
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mext_3241
   00930 Caprolactam degradation
    Mext_3241
Enzymes [BR:mex01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Mext_3241
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Mext_3241
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Mext_3241
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 DAO NAD_binding_2 UDPG_MGDP_dh_N F420_oxidored NAD_Gly3P_dh_N Sacchrp_dh_NADP FAD_binding_3 ApbA 2-Hacid_dh_C NAD_binding_8 Pyr_redox_2 GIDA AlaDh_PNT_C Shikimate_DH Pyr_redox TrkA_N NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: ABY31628
UniProt: A9VZ36
Position
complement(3593484..3595685)
Genome map
AA seq 733 aa AA seqDB search
MTATENFRFETDANGIALATWDMPGRSMNVITMEVMAELERIVDAVVADEAIKGCVIVSG
KNNFSGGADLTMLQGLGVEYERLKASEGEEVAMRHFFEESRRLSLVFRKLETCGKPFAAA
VHGLCLGGAFELALACHHRVLADDDKTRVGLPEIKVGLFPGGGGTQRVSRLMQTGDALQM
LFKGEQIRALMAKNMGLAHAVAPAAEIVERAKAWIREGGSAVAPWDVPKFKAPSGKVYSP
AGMMIWPPANAIYRRETHDNYPAAKAILASVYEGLQLPMDLGLRVESRYFAHILRTKEAQ
AMIRTLFISMGEINKGARRPKDVEATKVGKVGVIGAGFMGAGIAYVTAQAGMEVVLIDRD
QEAADAGKAHCHKLITGQINRGKAKTADRDALLARITATPDYGALSDCDLVIEAVFEDPK
VKAEVIAKVEAALPAHAIFASNTSTLPISGLAQTSKRPEQFVGIHFFSPVEKMLLVEIIR
GNQTGDRAVATALDYVRAIKKTGIVVNDSRGFFANRCVLAYIHEGHKMLTEGVPPAMIEN
VARMAGMPVGPLSLNDEVALDLGLKIMRATEAQLGEGAVDPDQKRLLVAMVETHGRLGRK
NKRGFYDYPEGGQKTLWPGLAEIQPNRLDPEGIDIDELKHRFLVVQALEAARTMQEGVVT
DPREADVGSILGFGFAPFTGGALSYIDFMGAKAFVALARQLEARHGARFTPPDNLLAMAE
SGARFYDALKQAA
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcaaccgagaatttccgcttcgagaccgatgccaacggcatcgcgctcgcgacc
tgggacatgccgggccgttcgatgaacgtcatcaccatggaggtgatggcggagctggag
cggatcgtcgacgcggtcgtcgccgacgaggccatcaagggctgcgtcatcgtctcgggg
aagaacaacttctccggcggcgccgacctcaccatgctccagggcctcggggtcgagtac
gagcggctgaaggcgagtgagggcgaggaggtggccatgcgccacttcttcgaggaatcg
cggcgcctcagcctcgtgttccgcaagctcgagacctgcggcaagccgttcgcggcggcg
gtgcacggcctgtgcctcggcggcgctttcgagctcgcgctggcctgccaccaccgggtg
ctcgccgacgacgacaagacccgcgtcggcctgcccgagatcaaggttggcctgtttccc
ggcggcggcggcacgcagcgcgtgtcccgtttgatgcagaccggcgacgcgctgcagatg
ctgttcaagggcgagcagatccgcgcgctcatggccaagaacatggggctggcccacgcc
gtcgccccggccgcggagatcgtcgagcgggccaaggcctggatccgcgagggcggctcg
gcggtggcaccgtgggacgtgccgaagttcaaggcgccgtccggaaaggtctactcgccc
gccggcatgatgatctggccgccggccaacgcgatctaccgccgcgaaacccacgacaat
tacccggccgccaaggcgatcctggcctcggtctacgagggcctgcaactgccgatggat
ctcggcctccgggtcgagagccgctacttcgcccatatcctgcgcaccaaggaagcgcag
gcgatgatccgcaccctgttcatctccatgggtgagatcaacaagggcgcccgccgcccg
aaggacgtcgaggcgaccaaggtcggcaaggttggcgtcatcggcgccggcttcatgggc
gcgggcatagcctacgtcacggcgcaggccgggatggaggtcgtgctgatcgaccgcgat
caggaggcggccgatgccggcaaggcgcattgccataagctcatcaccggccagatcaac
cgcggcaaggccaagaccgccgaccgcgacgccctgctcgcccgcatcaccgccacgccc
gattacggcgccctgtccgattgcgacctcgtgatcgaggcggtgttcgaggacccgaag
gtcaaggccgaggtgatcgccaaggtcgaggcggcgctgccggcgcacgcaatcttcgcc
tccaacacctcgaccctgccgatctccggcctcgcccagacctcgaagcggcccgagcag
ttcgtcggcatccacttcttctcgccggtggagaagatgctgctcgtggagatcatccgc
ggcaaccagaccggcgaccgcgcggtcgccaccgccctcgactacgtgcgcgcgatcaag
aagaccggcatcgtcgtcaacgattcccgcggcttcttcgccaaccgctgcgtgctcgcc
tacatccatgagggccacaagatgctcaccgagggcgtgcccccggcgatgatcgagaac
gtggcgcggatggccggcatgccggtcggcccgctctcgctcaacgacgaggtggcgctc
gatctcggcctcaagatcatgcgggcgaccgaggcgcagctcggcgagggcgccgtcgat
ccggaccagaagcggctcctcgtcgcgatggtcgagacgcatggccggctcgggcgcaag
aacaagcgcggcttctacgactaccccgagggcggccagaagacgctctggccggggctc
gccgagatccagccgaaccggctcgacccggaaggcatcgacatcgacgagctgaagcac
cgcttcctcgtggtgcaggcgctggaggccgcccgcacgatgcaggagggcgtggtgacc
gatccgcgcgaggcggatgtcggctcgatcctcggcttcggcttcgccccgttcaccggc
ggcgcgctctcctacatcgacttcatgggcgcgaaggccttcgtggcgctggcccggcag
ttggaggcccggcacggcgcccgcttcaccccgccggacaacctcctggcgatggccgaa
tccggggcgcgcttctacgacgcgctgaagcaggcggcgtaa

DBGET integrated database retrieval system