KEGG   Methylorubrum extorquens PA1: Mext_3244Help
Entry
Mext_3244         CDS       T00640                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mex  Methylorubrum extorquens PA1
Pathway
mex00071  Fatty acid degradation
mex00072  Synthesis and degradation of ketone bodies
mex00280  Valine, leucine and isoleucine degradation
mex00310  Lysine degradation
mex00362  Benzoate degradation
mex00380  Tryptophan metabolism
mex00620  Pyruvate metabolism
mex00630  Glyoxylate and dicarboxylate metabolism
mex00640  Propanoate metabolism
mex00650  Butanoate metabolism
mex00900  Terpenoid backbone biosynthesis
mex01100  Metabolic pathways
mex01110  Biosynthesis of secondary metabolites
mex01120  Microbial metabolism in diverse environments
mex01130  Biosynthesis of antibiotics
mex01200  Carbon metabolism
mex01212  Fatty acid metabolism
mex02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mex00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Mext_3244
   00630 Glyoxylate and dicarboxylate metabolism
    Mext_3244
   00640 Propanoate metabolism
    Mext_3244
   00650 Butanoate metabolism
    Mext_3244
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Mext_3244
   00072 Synthesis and degradation of ketone bodies
    Mext_3244
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Mext_3244
   00310 Lysine degradation
    Mext_3244
   00380 Tryptophan metabolism
    Mext_3244
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Mext_3244
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mext_3244
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Mext_3244
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mex04147]
    Mext_3244
Enzymes [BR:mex01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Mext_3244
Exosome [BR:mex04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mext_3244
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ABY31631
UniProt: A9VZ39
Position
complement(3597305..3598513)
Genome map
AA seq 402 aa AA seqDB search
MPEAYIYDHVRTPRGRGKPDGSLHEVTALRLAETALRALKDRNGLDTRQVDDVVLGCVDP
VGEAGGDIARAAALVADYGTHVPGVQINRFCASGLDAINFAAAQVMAGQHDLTVGGGVES
MSRVGLGASGGAWPVDPAIAVKSYFMPQGVSADLIATKYGFSRDDCDAYAVQSQKRSAQS
WDAGLFKNSVVSVRDINGITLLDRDEHMRPTTDMQSLASLKPSFVQMGQMGGFDAVAVDA
HPDVEAVHHVHHAGNSSGIVDGAAAVLIGSREAGDAAGLRPRARIRAFANIGSDPALMLT
GPVDVTKKVLARAGMSLSDIDLFEINEAFASVVLRFHQAFDLDPAKVNVNGGAIAMGHPL
GATGAMILGTVLDELERTGKERALVTLCIGAGMGTATIIERV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaggcctacatctacgatcacgtccgcaccccccgcggccgcggcaagccggat
ggttcgctgcacgaggtgacggcgttgcgcctcgccgagacggcgttgcgcgcgctcaag
gaccgcaacggcctcgacacgcggcaggtggacgacgtggtgctcggctgcgtcgatccg
gtcggcgaggccggcggcgacatcgcccgcgccgccgcgctcgtggccgattacggcacc
catgtgcccggcgtgcagatcaaccgcttctgcgcctcgggcctcgatgccatcaacttc
gccgcggcgcaggtcatggccggccagcacgacctcaccgtcggtggcggtgtcgaatcg
atgagccgcgtcggcctcggcgcctcgggcggcgcctggccggtcgatccggcgatcgcg
gtcaaatcctacttcatgccgcagggcgtctcggccgacctcatcgccaccaagtacggg
ttcagccgcgacgattgcgacgcctatgccgtccagtcgcagaagcgctcggcccaatcc
tgggacgcgggcctgttcaagaactccgtcgtgtcggtgcgggacatcaacggcatcaca
ctgctcgaccgcgacgagcacatgcggccgacgaccgacatgcagtcgctggcgagcctg
aaaccgtccttcgtgcagatgggccagatgggcggcttcgacgccgtggccgtcgatgcc
catccggatgtcgaggcggtccatcacgtccaccatgccggcaactcgtcgggcatcgtg
gatggcgcggcggcggtgctgatcggctcgcgcgaggccggcgacgcggcgggcctgcgg
ccccgcgcccgcatccgggcgttcgccaatatcggctccgatccggcgctgatgctgacc
ggcccggtcgatgtcacgaagaaggtgctggcgcgggccggcatgagcctgtccgacatc
gacctgttcgagatcaacgaggccttcgcctcggtggtcctgcgcttccatcaggccttc
gacctcgacccggcgaaggtgaacgtcaacggcggcgccatcgccatgggccatccgctg
ggtgccacgggcgcgatgatcctcggcaccgtgctcgacgagctggagcgcaccggcaag
gagcgggcgctcgtgaccctgtgcatcggcgccggcatgggcaccgccacgatcatcgag
cgggtgtga

DBGET integrated database retrieval system