KEGG   Methylobacterium extorquens PA1: Mext_3601Help
Entry
Mext_3601         CDS       T00640                                 

Definition
(GenBank) succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
mex  Methylobacterium extorquens PA1
Pathway
mex00020  Citrate cycle (TCA cycle)
mex00190  Oxidative phosphorylation
mex00650  Butanoate metabolism
mex01100  Metabolic pathways
mex01110  Biosynthesis of secondary metabolites
mex01120  Microbial metabolism in diverse environments
mex01130  Biosynthesis of antibiotics
mex01200  Carbon metabolism
Module
mex_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mex_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mex_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mex00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mext_3601
   00650 Butanoate metabolism
    Mext_3601
  Energy metabolism
   00190 Oxidative phosphorylation
    Mext_3601
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS DUF3043
Motif
Other DBs
NCBI-ProteinID: ABY31979
UniProt: A9VX86
Position
3980087..3980506
Genome map
AA seq 139 aa AA seqDB search
MSQVANRQNTALSMRTPRARVKGLGASGHGAGHFWLQRLTGASNALLMLAFVVIIALMAG
RTYPQAVALVSHPLVAIILILAVVSVTIHMRLGMQTVIEDYVHSHGLKFAALIANTFYAV
AVAAACLYAILRVSLGGLA
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgtcccaggtcgccaaccgccagaacaccgcgctctcgatgcgcacgccccgcgcccgg
gtgaagggcctcggcgcttcgggtcacggcgccggccatttctggctgcagcgcctgacc
ggcgcctcgaacgcgctcctgatgctcgccttcgtcgtgatcatcgcgctgatggccggg
cggacctacccgcaggcggtcgcgctggtgtcgcacccgctggttgcgatcatcctgatc
ctggccgtggtgtcggtgacgatccacatgcgtctggggatgcagacggtcatcgaagac
tacgtccacagccacggcctcaagttcgcggcgctcatcgccaacaccttctacgcggtc
gcggtggccgctgcctgcctctacgcgatcctccgcgtgagcctgggcggcctcgcctga

DBGET integrated database retrieval system