KEGG   Methylorubrum extorquens PA1: Mext_3939
Entry
Mext_3939         CDS       T00640                                 

Definition
(GenBank) ribosomal protein L9
  KO
K02939  large subunit ribosomal protein L9
Organism
mex  Methylorubrum extorquens PA1
Pathway
mex03010  Ribosome
Brite
KEGG Orthology (KO) [BR:mex00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Mext_3939
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:mex03011]
    Mext_3939
Ribosome [BR:mex03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    Mext_3939
  Bacteria
    Mext_3939
SSDB
Motif
Pfam: Ribosomal_L9_C Ribosomal_L9_N
Other DBs
NCBI-ProteinID: ABY32310
UniProt: A9W8G1
Position
complement(4379852..4380424)
AA seq 190 aa
MEVILLERVAKLGQMGETVNVRPGYARNFLLARGKALRATENNKKHFEAQRAQLEARNLE
RRNEAQTVAEKLDGQSFVLIRQSGETGVLYGSVSTRDLAEVVTKEGFSVERGQFVLNQPI
KTLGLHTVPVTLHPEVEVKVTVNIARSPEEAERQARGESVTEREQFNLDDLGLEVGQALA
DAGEGADDRG
NT seq 573 nt   +upstreamnt  +downstreamnt
atggaagtcatcctgctcgaacgcgtcgccaagctcggccagatgggcgagaccgtgaac
gtgcgtcccggctacgcccgcaacttcctgctcgcccgcggcaaggccctgcgcgccacc
gagaacaacaagaagcacttcgaggcccagcgcgcccagctcgaggcccgcaacctcgag
cgccgcaacgaggcccagacggtggccgagaagctcgacggccagagcttcgtgctgatc
cgccagtccggcgagaccggcgtgctctacggctcggtctcgacccgcgacctcgccgag
gtcgtcaccaaggagggcttcagcgtcgagcgcggccagttcgtgctcaaccagccgatc
aagacgctcggcctgcacaccgtgccggtgaccctgcaccccgaggtcgaggtcaaggtg
accgtcaacatcgcccgttcgccggaagaggccgagcgtcaggcccgcggcgagtcggtg
accgagcgcgagcagttcaacctcgacgacctcggcctcgaagtcggccaggccctggcc
gatgccggcgagggcgccgacgaccgcggctaa

DBGET integrated database retrieval system