KEGG   Methylorubrum extorquens PA1: Mext_4187Help
Entry
Mext_4187         CDS       T00640                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
mex  Methylorubrum extorquens PA1
Pathway
mex00450  Selenocompound metabolism
mex00970  Aminoacyl-tRNA biosynthesis
mex01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mex00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Mext_4187
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Mext_4187
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mex01007]
    Mext_4187
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mex03016]
    Mext_4187
Enzymes [BR:mex01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     Mext_4187
Amino acid related enzymes [BR:mex01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Mext_4187
Transfer RNA biogenesis [BR:mex03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Mext_4187
 Prokaryotic type
   Other AARSs
    Mext_4187
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: ABY32556
UniProt: A9VY02
Position
complement(4657601..4659169)
Genome map
AA seq 522 aa AA seqDB search
MSASEKANEPFLITTAISYPNGAPHIGHAYEVIATDAIARFHRLDGRDVLFTTGTDEHGL
KIQQTASRAGVTPRAFVDDMAGRFKAVADRLDCSYDRFIRTTEADHYAAAQELWRRMEAN
GDIYLAKYAGWYSVRDEAYYDEAETALGPDGNRRSIKTDTPVEWMEEENYLFRLSKYQEP
LLKLYAEQPDFLGPETRMNEVASFVRSGLKDLSISRTTFDWGVPVPDRPGHVMYVWVDAL
TNYLTVTGFPDAQAPNARFWPASLHIIGKDIVRFHAVYWPAFLMSAGLPLPKRVFGHGFF
LSRGEKMSKSLGNVVDPLDLVGTYGVDPVRYFLLREAPFGSDGNYDHEAIINRINADLAN
DLGNLAQRSLSMIAKNCEGTVPEPGAFTEADERLLAAAGALPEKARGLMQNLALHAILAE
IWAVVGEANRYFASEEPWKLRKSDPARMNTVLYVTVETLRRVGLMVQPFVPTAGAALLDL
LAVPVNARSFAFTGAEHRLQGGTALPAPAPIFPRFEKPEATA
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcgagcgagaaggcgaacgagcccttcctcatcaccacggcgatctcttacccg
aacggcgcgccgcatatcggccacgcctacgaggtgatcgccaccgacgccatcgcccgc
ttccaccgcctcgacgggcgcgacgtgctgttcaccaccggcaccgacgagcacggcctg
aagatccagcagacggcgtcccgcgccggcgtcacgccgcgcgccttcgtcgatgacatg
gccgggcgcttcaaggccgtggccgaccggctcgactgcagctacgaccgcttcatccgc
accacggaagccgaccactacgccgcggcccaggagctgtggcggcggatggaggccaac
ggcgacatctacctcgccaaatatgccggctggtactcggtgcgcgacgaggcctattac
gacgaggccgagaccgcgctcggccccgacggcaaccgccgctcgatcaagacggacacg
cccgtcgagtggatggaggaggaaaactacctcttccgtctctcaaagtaccaggaaccc
ctgctcaagctctacgcggagcagccggacttcctcggccccgagacgcggatgaacgag
gttgcgagcttcgtgcgctccggcctcaaggacctctcgatcagccgcaccaccttcgac
tggggcgtgccggtgccggaccggccgggccacgtcatgtatgtctgggtcgatgccctg
accaactacctgacggtgacgggctttcccgatgcgcaggcgccgaacgcccggttctgg
ccggcgagcctgcacatcatcggcaaggacatcgtccgcttccacgcggtctactggccg
gccttcctgatgtcggccgggctgccgctgcccaagcgcgtgttcggccacggcttcttt
ctcagccgcggcgagaagatgtcgaagtcgctcggcaacgtggtcgatccgctcgatctc
gtcggcacctacggcgtcgatccggtgcgctattttctcctgcgcgaggcgccgttcggc
agcgacggcaattacgaccacgaggcgatcatcaaccgcatcaacgcggacctcgccaac
gacctcggcaacctcgcccagcgctcgctctcgatgatcgcgaagaactgtgagggcacg
gtgccggagccgggtgccttcaccgaggccgacgaacgcctgctcgccgccgccggcgcc
ctgccggagaaggcacgggggctgatgcagaatctcgctttgcacgcgatcctggccgag
atctgggccgtggtcggcgaggccaaccgctacttcgcctccgaagagccgtggaaactg
cgcaagtccgatccggcgcgcatgaacacggtgctctacgtcacggtcgagaccctgcgc
cgggtcggcctgatggtgcagcccttcgtgccgacggcgggcgcggccttgctcgacctg
ctcgccgtgccggtgaacgcacgcagcttcgcttttaccggcgccgagcaccgcctgcag
ggcggcacggcgctgcccgccccggccccgatcttcccccgcttcgagaagccggaggcg
acggcctga

DBGET integrated database retrieval system